KEGG   Schizosaccharomyces pombe (fission yeast): SPAC56F8.10Help
Entry
SPAC56F8.10       CDS       T00076                                 

Gene name
met9
Definition
(RefSeq) methylenetetrahydrofolate reductase Met9
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00670  One carbon pool by folate
spo01100  Metabolic pathways
spo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SPAC56F8.10 (met9)
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     SPAC56F8.10 (met9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR Radical_SAM
Motif
Other DBs
NCBI-GeneID: 2542993
NCBI-ProteinID: NP_593224
PomBase: SPAC56F8.10
UniProt: Q10258
Position
I:1143115..1144926
Genome map
AA seq 603 aa AA seqDB search
MKISDKLLHPDWKEKVTYSYEFFPPKTSTGVQNLYNRIDRMKTWGRPMFVDVTWGAGGTS
SELTPGIVNVIQTDFEVDTCMHLTCTNMSTEMIDAALKRAHETGCRNILALRGDPVKDTD
WTEGESGFRYASDLVRYIRTHYNDEFCIGVAGYPEGYSPDDDIDESIKHLKLKVDEGADF
IVTQMFYDVDNFIAWVDKVRAAGINIPIFPGIMPIQAWDSFIRRAKWSGVKIPQHFMDTL
VPVKDDDEGVRERGVELIVEMCRKLIASGITRLHFYTMNLEKAVKMIIERLGLLDENLAP
IVDTNNVELTNASSQDRRINEGVRPIFWRTRNESYVSRTDQWDELPHGRWGDSRSPAFGE
FDAIRYGLRMSPKEITTSWGSPKSYSEIGDLFARYCEKKISSLPWSDLPISDEADLIRDQ
LLSMNRNAFLTINSQPALNGEKSSHPVFGWGPPNGYVFQKPYVEFFVHPSLLNELKETVK
KLNSVSYFVTNKNGDLDTNSQYEIPNAVTWGVFPNREIIQPTIVESTSFLAWKDEAYSLG
MEWANAYSPDSISRKLLVSMMKEWFLCVIVDNDFQNGQSLFDVFNKMRSLKDIHPELYYA
NAS
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagtgacaaattacttcacccggattggaaggaaaaagttacttacagttat
gaattttttcctccaaaaacgagcactggtgtccaaaatctttacaatcgtatagatcgc
atgaagacttggggtcgtcccatgtttgtcgatgtgacttggggtgctggtggtacttct
tcagaactgactcctggaatcgttaatgtaattcaaacagattttgaagtggatacttgc
atgcatttgacttgtacgaacatgtccacagaaatgattgacgcagctttgaaacgggct
catgaaacagggtgtcgtaacatattggcccttagaggtgatcctgttaaagatacagac
tggactgaaggcgaaagtggattccggtatgcttcagacttagttagatatattcgcaca
cattataatgatgaattctgtattggtgtagctggctatccagaaggatattcaccagat
gatgacattgatgaaagcataaagcatctgaaattaaaagtcgatgaaggtgctgatttt
atcgttactcaaatgttttatgatgtagacaattttatcgcatgggtcgataaagtgcgt
gcagcaggaataaatatccctatatttccgggcattatgcctattcaggcatgggattcc
tttattcggagagcgaaatggagcggtgttaaaattccccagcattttatggatactcta
gtcccagttaaagacgatgatgaaggagtccgtgagcgtggtgttgagctcatagtcgaa
atgtgccgtaagcttatagctagtggcattacgagacttcatttttacactatgaattta
gaaaaggccgttaaaatgattattgaacgattaggtttattagatgaaaacttggctcct
atagtggatactaataacgtcgagttaaccaatgcttccagtcaagatcgtcggataaat
gaaggtgtacggcccattttctggcgcactcgtaatgaaagttatgtctcgcgtactgat
cagtgggacgaattaccgcatggtcgttggggtgactctcgtagccctgcttttggcgaa
tttgatgctattagatatggtcttcgtatgtctcccaaggagatcacaacatcgtggggg
tctcctaaatcttactcggaaatcggcgatttgtttgccaggtactgtgaaaaaaagatt
agctccctcccttggagtgatcttcccatatccgatgaagccgacttgattcgggatcaa
cttctaagtatgaatagaaacgctttccttactataaattctcaacctgctcttaacggc
gaaaagagttcacatcctgtttttggatggggaccacctaatggttatgttttccaaaaa
ccatacgttgagtttttcgttcacccctcactcttgaatgaactcaaagaaaccgttaaa
aagcttaattcagtttcctactttgttacaaacaagaatggagacttggataccaactca
caatatgagattccaaatgcggttacatggggtgttttccctaatcgtgagattatccaa
cctactattgtcgagtcaacctcttttcttgcttggaaagatgaagcctattcattgggc
atggaatgggctaatgcatatagccctgattcaatttctcgtaaacttttggtttctatg
atgaaggaatggttcctttgtgtcatagttgataacgattttcaaaatgggcaatctttg
tttgatgtttttaacaaaatgagatctttaaaagacatccatcctgagctatattatgca
aatgcatcataa

DBGET integrated database retrieval system