KEGG   Schizosaccharomyces pombe (fission yeast): SPAC57A10.03
Entry
SPAC57A10.03      CDS       T00076                                 

Gene name
cyp1
Definition
(RefSeq) cyclophilin family peptidyl-prolyl cis-trans isomerase Cyp1
  KO
K12733  peptidyl-prolyl cis-trans isomerase-like 1 [EC:5.2.1.8]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    SPAC57A10.03 (cyp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:spo03041]
    SPAC57A10.03 (cyp1)
   03110 Chaperones and folding catalysts [BR:spo03110]
    SPAC57A10.03 (cyp1)
Enzymes [BR:spo01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     SPAC57A10.03 (cyp1)
Spliceosome [BR:spo03041]
 Complex B
  Other components
   Prp19-related factors
    SPAC57A10.03 (cyp1)
 Complex C
    SPAC57A10.03 (cyp1)
Chaperones and folding catalysts [BR:spo03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    SPAC57A10.03 (cyp1)
SSDB
Motif
Pfam: Pro_isomerase
Other DBs
NCBI-GeneID: 2543019
NCBI-ProteinID: NP_593308
PomBase: SPAC57A10.03
UniProt: P87051
Structure
PDB: 
3JB9

Position
I:join(1368211..1368240,1368281..1368322,1368388..1368441,1368646..1368725,1368808..1368904,1368945..1369109)
AA seq 155 aa
MANVELQTSLGKILIELYTEHAPKTCQNFYTLAKEGYYDGVIFHRVIPDFVIQGGDPTGT
GRGGTSIYGDKFDDEIHSDLHHTGAGILSMANAGPNTNSSQFFITLAPTPWLDGKHTIFG
RVVSGLSVCKRMGLIRTDSSDRPIEPLKIIKAVAL
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctaatgtagagttacaaacaagtttgggaaaaattcttattgaattgtatacagaa
catgctcctaaaacatgtcaaaatttctatactttagcaaaagaaggatactatgatggt
gttatttttcacagagttattccagactttgtaattcaaggaggggatcccacaggtaca
ggtcgaggtggaacttctatatatggggataaatttgacgatgagattcattccgattta
catcacactggagctggcattttatcaatggccaatgctggacctaacacaaattcatca
cagttttttatcactctagcacctactccttggttagacggaaaacatacaatttttggt
cgtgttgttagcgggctttctgtgtgcaagcgtatgggtcttatccgaacggattcatct
gaccgcccaattgaacctttaaaaatcattaaagctgttgcactttaa

DBGET integrated database retrieval system