KEGG   Schizosaccharomyces pombe (fission yeast): SPAC57A10.05cHelp
Entry
SPAC57A10.05c     CDS       T00076                                 

Gene name
pof1
Definition
(RefSeq) F-box/WD repeat protein protein Pof1
  KO
K10259  F-box and WD-40 domain protein MET30
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04111  Cell cycle - yeast
spo04120  Ubiquitin mediated proteolysis
Module
spo_M00379  SCF-MET30 complex
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPAC57A10.05c (pof1)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    SPAC57A10.05c (pof1)
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     SPAC57A10.05c (pof1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 F-box-like F-box Nup160 WD40_like F-box_4
Motif
Other DBs
NCBI-GeneID: 2542914
NCBI-ProteinID: NP_593310
PomBase: SPAC57A10.05c
UniProt: P87053
Position
I:complement(1373066..1374883)
Genome map
AA seq 605 aa AA seqDB search
MTTGYESVPTSEPSDNLAPRAELWQRHLLEKKEGDQSISVSAFNISSMHNELSGLSEKSR
QRVEAVWAAFSEASCSERKLALQGILNNCSSSLLSFASSTLDSLVRLDFLSLLPVEISFR
ILSFLDARSLCQAAQVSKHWKELADDDVIWHRMCEQHINRKCEKCGWGLPLLERNTLYAA
KASIQKRYERLTKRGVDQAHESSPVKKAKLDDYPTSSNEETISSVKPPSPNSDSKFFLPF
KTRPWKEVYAERCRVECNWRHGRCRQVVLSGHSDGVMCLQLVRNILASGSYDATIRLWNL
ATFQQVALLEGHSSGVTCLQFDQCKLISGSMDKTIRIWNYRTSECISILHGHTDSVLCLT
FDSTLLVSGSADCTVKLWHFSGGKRITLRGHTGPVNSVRIIRDRGLVLSGSDDSTIKIWS
LETNTCLHTFSAHIGPVQSLALADSRLFSCSLDGTIKQWDIEKKKCVHTLFGHIEGVWEI
AADHLRLISGAHDGVVKVWEACECVHTLKNHSEPVTSVALGDCEVVSGSEDGKIYLWLFN
NAPNESPVSTQSVPISSLNGQRSNSSVQRALSSVPNYSSSLSNISTRNLNIPPSNANNDD
VSIQS
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgactacaggttatgaatctgttcccacttccgaaccctctgataatcttgcaccacga
gcagagctatggcaacgccatttactggaaaaaaaagaaggtgatcaatccatctccgtt
tcggcttttaatatttcttcaatgcataatgaattgtctggtttaagcgaaaaaagtcgt
caacgtgtcgaagctgtatgggctgctttttcagaggcttcttgcagcgaacgtaaactc
gctttgcaaggcattttaaacaactgttcgtcctctcttctctcttttgcctccagcaca
ttagattctctagtacgcttagattttctctctttgctccctgttgaaatttcgtttcgc
attttatcttttttggatgctagaagcctttgccaagctgcacaagtcagtaaacattgg
aaagaacttgctgatgatgatgttatatggcatcggatgtgtgaacaacatattaatcga
aaatgtgaaaaatgcggctggggacttccgttactcgaaagaaataccttatacgcagca
aaggcttccatacaaaaacgttatgaacgacttacaaaaagaggcgtcgatcaggctcat
gaatcttcacccgtcaaaaaagcaaagctggacgattatccgacgtcgagtaatgaagag
actatttcttctgtcaaaccaccttctccgaactccgattccaaattctttcttcccttt
aaaaccagaccatggaaagaagtatatgctgaacgttgtagagttgaatgcaactggcgg
catggtcgttgtcgccaggttgttctcagtggccactctgacggtgttatgtgtctacaa
cttgtaaggaacattcttgctagcggcagttatgatgccactatacgattatggaatctt
gctacctttcaacaagttgctctattagaaggtcatagcagtggtgttacgtgccttcaa
ttcgatcagtgtaaacttatcagcggttcaatggacaaaactattcgtatatggaactac
agaacctctgaatgcatttctattttacatggtcatacggatagtgttttatgcttaacg
tttgactctacgctacttgtttctggaagcgcagattgtacagttaagctgtggcacttt
tctggcggtaagcgtatcactttacgcggtcacacaggacctgtcaattctgtccgcata
attagagatcgtggacttgttctttccggttccgacgattccaccatcaagatttggtct
ttggaaacaaacacgtgtcttcatactttcagtgctcatattggccctgtccagagttta
gctcttgctgattcgcgattgttttcttgctcattggacggcacaataaagcaatgggac
atcgagaagaaaaaatgtgttcatacattgtttggacacattgaaggtgtatgggaaatt
gcggcagatcaccttcgtttaatctcgggagctcatgatggtgttgttaaagtttgggag
gcttgtgaatgtgttcacacgttgaagaatcactcggagcctgtaacctcggttgctctt
ggagactgtgaggtagtcagtgggtctgaagatgggaaaatatatttgtggcttttcaat
aatgctccaaatgaatctccagtatctacacaatctgttccgatatcttcccttaatggt
caaaggtcaaattcaagtgtgcaacgagctctttcttcagtacccaactactcatcctcg
ttatccaatatctcaaccagaaatttaaatatcccaccctctaatgccaataatgacgat
gtgtcgattcaatcgtag

DBGET integrated database retrieval system