KEGG   Schizosaccharomyces pombe (fission yeast): SPAC57A10.09c
Entry
SPAC57A10.09c     CDS       T00076                                 

Gene name
nhp6
Definition
(RefSeq) putative High-mobility group non-histone chromatin protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: HMG_box HMG_box_2 Ccdc124
Other DBs
NCBI-GeneID: 2542878
NCBI-ProteinID: NP_593314
PomBase: SPAC57A10.09c
UniProt: P87057
Position
I:complement(join(1380838..1380975,1381268..1381326,1381407..1381536))
AA seq 108 aa
MPRAAKSSRKKDPNTPKRNMSAFMFFSIENREKMKTDNPDATFGQLGSLLGKRWKELTST
EREPYEEKARQDKERYERERKEYDTKLANGEKTGKASAPAAAAAAKEE
NT seq 327 nt   +upstreamnt  +downstreamnt
atgcctagagccgcaaaatccagccgtaaaaaagatccaaatactcctaaacgcaatatg
tcggcgtttatgtttttttccattgagaaccgcgaaaagatgaaaacagacaaccctgat
gccacctttggccagctaggatctttgttgggcaaaagatggaaagagcttacaagcaca
gaacgtgagccatacgaggaaaaagctcgtcaggacaaagaacgttatgaacgtgagaga
aaagagtacgacactaaactagctaatggtgaaaaaactggtaaagcttcagctcctgct
gctgctgctgccgccaaagaggaataa

DBGET integrated database retrieval system