KEGG   Schizosaccharomyces pombe (fission yeast): SPAC57A7.05
Entry
SPAC57A7.05       CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: ArAE_2 ArAE_2_N FUSC_2
Other DBs
NCBI-GeneID: 2542893
NCBI-ProteinID: NP_593376
PomBase: SPAC57A7.05
UniProt: P87136
Position
I:complement(1534588..1538601)
AA seq 1337 aa
MPTSGAPSNLDRANAQLSNTSSTESSSSNNSSTASGSRHVKIESNRVSLPPLKIQKGSFP
AIRQPTESSTHFQSSHSVSNAHNQSPLNQSQSSANPVTFEIADEPSPSFNHSFFEKDNAR
DIPQQPSHSQNPSSSSSSSSSQSSQHSTHLQFQIPSNEKKSLDDPSPRRKPSFFSKSNLK
RKYRYLKNPDAWNLPPSLQFIPKNLNRKGLKPVIRAAINSWIAFLLVLARHTNRVLGMSS
FFVVITSILVPAMEPIAPMLWKTLFQFLLLFSAYAWTVLAAKLATVARGSPSREASLAQA
VSEGFVCPDPSQGFNYCIREAVFQGYFVRPLPSIIWALFEFSAVALFIRLKMKYPPLNFP
CVFSIICTAVSANMGPMYPYFYPRIGLFFIVPNCVQTGITIGCTLFILPETCNHAYNTML
CKLTEDTSSFLKRQTEMLSHSPASSHWASFSSLENEIANLKNLLSKMKSTELFLDMEFSY
GRLKGEDLVSIQRIFKKTILRLSAFSYFQRLIDHNMQIYDDETIQKAGEATVSSWLNTPA
LSAASARTSSGRNSSESDRVSYFGLAPVNATTQDSERNGEEIRRLASKQLNVPVNNNFRT
VGYASPSNASTASFNDIVQRGRSHVRTGSNNSEAPLAAKTSTTKRNGDLLEPQSPSLRSH
KSRLHLPSSLGKFYKKRKKSYKPVGVLEAQQYLALESRLPFNKPQFLDSLLSILKNSSGD
LFDQAIYSLDALNAWLVELNHDRIKKIFSKRDQKAAGRDRLKLIKLHYDHLSQALHEYER
EKCFDVRKPYESLFQNQDVQQFYMHSLRSLFVVYYYESHLMQAVRGILQILETVIDLEER
RPIRRLWWPLRSIRRSLLSQLTGHQGDYDENIHNDVDKDMNQSSTQPRDPDADHPSSLYH
ICGYRLTKFFKSIFRPMNVFVLKVGTLAVICTIPAFCRSSAGWYYRNRGLWAVILAIMSL
QRFTADTVYGYLMRIFGTFFGAILGMVIWYTGSGHGLGNAYGLAAVWGAAIPFIQFIRVH
FVILTPMPAVIFCVTAALTVTYSWKSNHEPGVVTLGIGWDVAYRRFLTVAAGITVAFIFS
FLPQPRTAKYAVRKNIGNTLIDIGSIHCEISNFARRPVHNHIDPDIQSKVLNLSNTIQSL
IGRLNMVNFEPSFKGRWPMEKYQLLCKTQLELVDLLNSLMTTITTLEDRWLFALLYRVGW
LDHKFVADQLAVLYMSSNALQTGNPLPQVVPSPLVDRFFTTSGDVFLPPGLNDAPVPIPK
AMEYELLNNMQYLNFAVGCTIAYAVVNHIDRIMFITKSLCGEIFEIDKWPFHFDDEYLYT
CHPTNSPDQRKSPHDLV
NT seq 4014 nt   +upstreamnt  +downstreamnt
atgccgacttcaggtgcgcctagtaaccttgatcgtgcaaatgctcagttgtcgaacacg
tcctctaccgaatcctcttcctctaacaattcctctaccgcctctggttcccgccatgtg
aaaattgaatcaaaccgcgtttctcttccaccactcaaaattcaaaagggttcgtttccc
gccattcgccaacccactgagtcaagcacgcattttcaatcctctcattccgtttccaat
gcccacaatcagtctcctctcaatcaatcacagtcctccgctaatccagtgacgtttgaa
atcgccgatgaaccatctccttcatttaatcactcgttcttcgaaaaagataatgcccgc
gacattcctcagcaaccttcccattctcaaaacccatcctcctcctcctcctcctcttcc
tctcaatcctcacaacattctacgcacctccaatttcaaataccttctaatgaaaaaaag
tcccttgacgatccttcccctcggcgaaagccttcatttttctcaaaaagcaacttaaaa
cgtaagtatcgctatcttaaaaatcccgatgcctggaatttacctccttctttgcagttt
atcccaaaaaatcttaatagaaaaggcttgaaacctgtcattcgtgctgccataaactca
tggattgcttttctccttgttctcgctcggcacaccaatcgagtgcttggtatgtcgagc
ttttttgtcgtgatcacttctattctcgttcccgcaatggagcccattgcgccaatgttg
tggaaaactttgtttcaatttcttctcctttttagcgcctatgcttggactgttcttgct
gccaagttggcaactgttgctcggggttctccatctcgagaggcatctttggcacaggct
gtctccgagggtttcgtatgtccagatccatcccaaggctttaattattgtattagggaa
gcagttttccaaggctactttgttcgtcctttgccctcgatcatctgggcactctttgag
ttttcagcggttgctttattcataagactcaaaatgaaataccctcctctcaattttcca
tgcgttttttcaattatctgcactgctgtcagtgcaaacatggggccaatgtacccttac
ttttatcctcgcattggcttgttttttatcgttcccaattgtgttcaaacaggcattact
attggttgtactctatttattttacctgaaacctgtaaccatgcttacaatactatgctt
tgtaagcttacagaagatacaagctcttttctaaaacggcagactgagatgttatcacat
tctcctgcatcgagtcattgggcttctttttcatctctagaaaatgaaattgcaaattta
aaaaatctgttatcaaagatgaaatcgactgaactgttcctggacatggaattttcgtat
ggtcgtttgaagggtgaggatttggtctcaattcaaagaatctttaagaaaacaattctt
cggctttccgctttttcttattttcaaagactgatcgatcataatatgcaaatatacgat
gacgaaacaatccagaaagctggggaggctaccgtatcttcttggttaaacacgccagcc
ttgtctgccgcttctgcaagaacatcatcgggtaggaactcttctgaaagtgaccgagtc
tcttatttcggtctggcacccgtaaatgccactactcaagatagtgaaaggaatggtgag
gagattcgtagactcgctagcaaacagctaaatgttccggtcaataataactttcgaacg
gtcggatatgcgtcccctagcaatgcatctacagcatccttcaatgatatcgttcaacgc
ggacgcagccatgttaggacaggctctaataacagcgaagcaccattggccgctaagact
tcaactactaagcgtaacggagatttattggaaccacagtcaccaagtcttcgaagtcat
aagagtcgtcttcatcttccttcttctttgggaaagttttacaagaaaagaaaaaagagc
tataaacctgttggagttctagaggcacagcaatatttagcattggagagcagattgccg
tttaacaaaccacaatttttagactctctgctttctattttaaaaaactcttcaggagac
ttatttgatcaagctatttattcattggatgctctgaacgcgtggcttgtggaattaaat
catgatcgtataaaaaaaatttttagtaaacgtgatcaaaaagctgctggaagagatcgt
ctaaaactcatcaaactccattatgatcatttgtcacaagcacttcacgaatatgaaaga
gagaagtgctttgatgtgcgaaagccttacgaatcgctattccaaaatcaagacgttcag
cagttctatatgcattcacttaggtcacttttcgttgtatattattatgagtcacatttg
atgcaagcagtgcgtggtatattacaaattctagaaacggttatagatctggaagagcgg
cgtcctatccggcgattgtggtggcctttaaggtctataagaagatctttattatcgcag
ctgacaggacatcaaggtgattatgatgaaaatatccacaatgatgtagacaaagatatg
aatcaatctagcacacaacctagagatcctgatgctgatcatccttcctctctgtatcat
atttgtggttacagattaaccaaattctttaaatctatcttccgcccaatgaacgttttt
gtactaaaagtcggtacgctggccgttatctgcactatacctgctttttgcagaagcagc
gcaggatggtattatagaaatcgaggtctatgggcagtcatcttggctatcatgagtctg
caaagattcactgcagatactgtgtatggctacctgatgagaatttttggaacttttttt
ggtgcaattctcggtatggtgatttggtacacaggttctgggcatggtttgggtaatgcc
tatggcttagctgctgtctggggagcagccattccatttattcagtttatcagagttcat
tttgtaatattaactccaatgcctgctgtgatcttctgtgtaaccgcagcattaactgta
acgtactcttggaaatctaatcatgagcctggtgtagtaacacttggaattggttgggat
gttgcttatcgtcggtttttgacagtagctgctggaattacagttgcttttattttttcc
tttcttccacaacctcgtacagccaaatacgctgttagaaaaaatattggcaatacctta
attgacattggatcaattcattgtgagatttcaaatttcgcaagaaggcctgtacataat
cacattgatccagatattcagagtaaggtgctcaatttgtcgaataccatacaaagttta
atcggaagattaaatatggtaaacttcgagccaagcttcaagggaagatggcctatggaa
aaataccaacttttgtgcaaaacgcaacttgaattggttgacctgctgaattcattgatg
acaaccataacgactctggaagatcgatggttgtttgcattgctttaccgtgtaggatgg
ttagatcacaagtttgtagcggatcagcttgccgtattatatatgtcttctaatgccctg
caaaccggaaatccgcttccacaagtggttccttcaccgttggtcgatagattttttaca
accagcggagacgtgttcctgccaccaggcttaaacgatgcccctgtccctattcccaag
gcgatggagtacgaattgcttaacaatatgcagtacttaaactttgctgttggttgtaca
atcgcttacgctgttgtgaatcacattgaccgtatcatgtttataactaaatctttatgt
ggagaaatatttgaaattgacaaatggccattccattttgacgacgagtatttgtatact
tgtcatccaactaatagccccgatcagagaaaatctcctcatgacttagtctag

DBGET integrated database retrieval system