KEGG   Schizosaccharomyces pombe (fission yeast): SPAC57A7.10c
Entry
SPAC57A7.10c      CDS       T00076                                 

Gene name
sec21
Definition
(RefSeq) putative coatomer gamma subunit Sec21
  KO
K17267  coatomer subunit gamma
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPAC57A7.10c (sec21)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPAC57A7.10c (sec21)
Membrane trafficking [BR:spo04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    SPAC57A7.10c (sec21)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SPAC57A7.10c (sec21)
SSDB
Motif
Pfam: Adaptin_N COP-gamma_platf Coatomer_g_Cpla HEAT_2 Cnd1
Other DBs
NCBI-GeneID: 2542247
NCBI-ProteinID: NP_593371
PomBase: SPAC57A7.10c
UniProt: P87140
Position
I:join(1521712..1521742,1521787..1523837,1523897..1524532)
AA seq 905 aa
MSYSKKDDDGDESIFANVNQVTVTQDARAFNSSSISPRKSRRLLSKIAYLIYTGEHFQEK
QATELFFGITKLFQHKDPSLRQFVYIIIKELSVVAEDVIMITSSIMKDTATGRETIYRPN
AIRSLIRVIDANTVPAIERILTTGIVDPISAVASAALVSAYHLYPVAKDIVSRWNNEVQD
AVTSHNVGRKVASSPFFTSTLGYTPNASGISQYHALGLLYRIRRHDSIAMNKLLQLLVSN
LGTVSNSHAFVMLIRYISSLMDQNTQFRDQMVPFLHGWLKSKGDMVNLEVARNMVRLKNI
SDDDLQPVVSVLKIFLSSHRSATRFSAIRTLNELAMTRPHLVHSCNLNIESLITDVNRSI
ATYAITTLLKTGNDESVDRLMKQIVTFMSDISDNFKIIVVDAIRSLCLKFPRKQDSMLTF
LSNILCDEGGYEFKRAAVDAISDMIKYIPESKERALAELCEFIEDCEYPKIAVRILSILG
EEGPKASEPTRFIRYIYNRIMLENAIVRSAAVSALTKFGLNAEDKFVQRSVKVILTRCLE
DADDEVRDRAAFSVKALEDRDAFLPVVKSDKIPSLPALERSLVIYISERKFGQGFDIKSV
PVLSQEEIDAENLRIKKATTEVEFTEVTPAEDQNALASSNIETEFLNALESVSEFNEYGP
VLKSSPSPIELTEQETEFVVKVVKHVFKDHLVVQFQLHNTLSEVILENAVVVSTPSTDDL
VEECVVPAAIVSGEPVSIFVSFKFNDSVPYPLTTLTNTLQFTTKEIDIHTGEPEEEGYED
EYKIDDLDVSAGDFISPAYESNFDGLFDSLEHEASEVYVLSLLDSFRSTCSRVAELLQMQ
PLEGTENPTDKPVHVMKLSGKLVNGEKVLALVKMAHSKDGEGITIKVIARGESDSSVELV
VGGIA
NT seq 2718 nt   +upstreamnt  +downstreamnt
atgagttattctaaaaaagatgatgatggtgacgaatcgatatttgccaatgtcaatcaa
gtcacagtaactcaagatgctagggcttttaattcatcttccataagccctagaaagagt
agacgtcttcttagcaaaatcgcctacttgatatatacgggagagcatttccaggaaaag
caagctacagaactcttttttggtattactaaacttttccaacacaaagaccctagtctt
cgccaatttgtttatattattatcaaggagctttccgttgttgctgaagatgtgattatg
attaccagtagtatcatgaaagacaccgctacgggacgtgaaactatataccgtcctaat
gctattcgctctttgattcgtgtcattgatgctaacactgtccctgcgattgaacgcatt
ttaactacgggtattgttgaccccatatcagctgttgccagcgctgctcttgtttccgca
tatcatttatatcctgttgcgaaagacattgtatcgcgttggaacaacgaggttcaagac
gcggtcacatctcataatgttggtagaaaagttgctagctctccttttttcacctctacc
ttgggttacacaccaaatgccagcggcatttctcaatatcatgctttaggtcttctgtac
cgtattcgaagacatgattcgattgcaatgaataagttattgcagctgcttgtaagcaat
ttaggaacagtctcaaattctcatgcatttgttatgcttatccgctacatttctagtcta
atggatcaaaacactcaatttagagaccagatggttccatttctacatgggtggttaaaa
agtaaaggagacatggtaaacttagaagttgctagaaatatggtccgtctcaaaaatatc
tcagatgatgacttgcaacctgtggttagcgttcttaaaattttcttgtcgtctcaccga
tccgctacccgattttcagctattcgtacgcttaacgagttagccatgacacgtccacac
ttagtacattcctgcaatcttaatatcgagtctttaattaccgacgtgaatcgctccatt
gccacctacgctatcacaacacttctaaagactggtaatgatgagtctgtcgaccgtttg
atgaaacagattgttacctttatgtccgatatttcagataatttcaaaattatcgtcgtt
gatgccattcgttctttatgtctaaaatttcctcgcaagcaagattcaatgcttaccttt
cttagtaatatactttgcgatgaaggtggttatgaatttaaacgtgctgccgttgatgct
atttctgacatgattaaatacattccggaatctaaagaacgagcccttgccgagttatgt
gaatttatagaggattgtgaatatcctaagattgcggtacggattttatctattctcggc
gaagaaggtcctaaagcctcagaaccaacgagatttatccgctatatttacaatcggatt
atgcttgagaatgccatcgtacgttccgctgccgttagcgctttgaccaaatttggattg
aatgcggaagataaatttgtccaacggagtgttaaggttattctcacaaggtgtttggaa
gatgctgatgacgaggttcgtgatcgtgctgcttttagtgtaaaggcgcttgaggataga
gatgcatttttgccagtggttaaatctgataaaattccctcattacctgctttagagcgt
agccttgttatatatatttctgaaaggaagttcggacaaggctttgatatcaaatctgtg
cccgtactatctcaagaagagattgatgctgagaatttgagaatcaaaaaggccacgaca
gaggtagagtttacagaggttactcctgctgaggaccaaaatgctcttgccagttctaac
attgaaaccgagtttttaaacgcattagaatccgtttcagaatttaatgaatatggccca
gtactgaaatcatcgccgtcacctattgagctcactgagcaggaaactgaatttgttgtt
aaggtcgttaagcatgtgttcaaagaccatcttgtggttcagtttcaacttcataacact
ctgtccgaagttatcctagaaaatgctgtcgtggtttctactccttctactgacgacctt
gtggaagaatgtgtcgtcccagctgccatcgtttcaggagaaccagtttctatctttgtc
agttttaaatttaatgactcggttccttaccctcttactacccttactaacactcttcaa
tttactacgaaagaaatcgacatccatactggtgaaccagaagaagagggttacgaagat
gagtacaaaattgatgacttggatgtctcggccggtgattttatttctcctgcatacgaa
tcgaactttgatggtctttttgatagtcttgaacatgaagcttctgaagtttacgtactc
agtctgctagattcgtttagaagcacatgctcacgagtagctgagttacttcaaatgcaa
cctctcgagggcacagagaatcctactgacaagccagtgcatgttatgaaactctccggt
aaacttgttaacggagaaaaggtacttgcattggtgaagatggctcactcaaaagatggc
gaaggtattacaattaaagtaatagctcggggtgagagtgacagctctgttgagttggta
gttggaggaattgcatag

DBGET integrated database retrieval system