KEGG   Schizosaccharomyces pombe (fission yeast): SPAC5D6.10cHelp
Entry
SPAC5D6.10c       CDS       T00076                                 

Gene name
mug116
Definition
(RefSeq) protein mug116
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Claudin_2 Ac76
Motif
Other DBs
NCBI-GeneID: 2542043
NCBI-ProteinID: NP_593359
PomBase: SPAC5D6.10c
UniProt: O14202
Position
I:1494670..1495077
Genome map
AA seq 135 aa AA seqDB search
MVSRVESVIVFALYKFLQRYFHSFHCFFLLCFTVMLCVVQQCSSAMTSFRCPTFSLSKYT
CVLPASIPEMILFTFSSHTFQTPTKKGNKTKKKRKKEKKKETIVEKNKVLKSFALYKKIN
NYRSTRCVLVCQCKY
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggttagtagagttgaatcagtaattgtattcgcattgtataaattcttacagaggtat
tttcatagttttcattgtttttttcttttgtgttttaccgtgatgctatgtgttgtccaa
caatgctcgtcagcaatgaccagttttcgttgtccaacattttcattgtccaaatacacc
tgtgtccttcctgcttccatccctgagatgattctctttacattttcatcccatacattc
caaactccgactaagaaaggaaacaaaacaaaaaaaaaaagaaaaaaagaaaaaaaaaaa
gaaacgattgttgagaaaaacaaagtcctcaaaagttttgctctctacaaaaaaataaat
aattatcgttcaactcgatgtgtgttggtgtgccaatgtaaatattaa

DBGET integrated database retrieval system