KEGG   Schizosaccharomyces pombe (fission yeast): SPAC630.10
Entry
SPAC630.10        CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
  KO
K18849  25S rRNA (adenine2142-N1)-methyltransferase [EC:2.1.1.286]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spo03009]
    SPAC630.10
Enzymes [BR:spo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.286  25S rRNA (adenine2142-N1)-methyltransferase
     SPAC630.10
Ribosome biogenesis [BR:spo03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   SPAC630.10
SSDB
Motif
Pfam: Bmt2
Other DBs
NCBI-GeneID: 2543414
NCBI-ProteinID: NP_592906
PomBase: SPAC630.10
UniProt: Q9UUH2
Position
I:365550..366362
AA seq 270 aa
MRPIPVKNRIGKNNIDNAKGLKGNKLIRHYHNLLKEKSRLIASSAPIEKIKNVESELENI
GIDAYQRASRSGQAEGKGGDSSKILIKWIRTTPCFSYCARLKEPKDLLEIGSVSVDNKCS
TCGLFRVSRIDLHSVHPLIKQQDFLERTPEEGLFTGISCSLVLNFAPPELRAKMLLHCTG
LLMPPNKEQPPWLFLVLPSPCITNSRYMDEKTLHSIMIQFGFICRQKSISKKIAYYLYSY
ECFPMKEIDWKKKIVNDGATRNNFFIPCIL
NT seq 813 nt   +upstreamnt  +downstreamnt
atgcgtcccattccagtgaagaatcgcattggaaaaaacaacattgataatgcaaaggga
ctgaaggggaataagcttattcgtcattatcataacctgttaaaagagaaatctcgactt
attgcgtcaagtgctccgattgaaaaaataaaaaatgtggaaagtgaactcgaaaatata
ggtattgatgcttaccaacgagctagtcgatccggtcaagcggaaggaaaaggaggggat
tcaagtaaaatattgataaaatggattcggacaactccctgtttttcgtattgcgcacgt
cttaaggagccgaaagatttgttggaaattggcagtgtttctgttgacaacaaatgttca
acttgtggacttttccgagtttcaaggattgatttgcattctgttcatcccttgattaaa
caacaggactttcttgaaagaactcctgaagaaggactttttactgggataagttgttca
cttgtgctgaattttgcacctccagaactccgagctaaaatgttattacattgtacagga
ttgttaatgcctcctaataaagaacagcctccttggttatttttggttttgccttcgcct
tgcataacaaattctcggtacatggatgaaaaaacattacactcaattatgatacagttt
ggatttatctgtcgtcaaaagtctatatcgaaaaaaatagcctactatttatattcttac
gagtgttttcctatgaaagaaatagactggaaaaagaagatcgttaatgatggggcaact
aggaataatttcttcattccctgtatactctaa

DBGET integrated database retrieval system