KEGG   Schizosaccharomyces pombe (fission yeast): SPAC631.02
Entry
SPAC631.02        CDS       T00076                                 

Definition
(RefSeq) putative bromodomain-containing protein
  KO
K11684  bromodomain-containing factor 1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPAC631.02
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Chromatin remodeling factors
   SWR1 complex
    SPAC631.02
SSDB
Motif
Pfam: Bromodomain BET
Other DBs
NCBI-GeneID: 2543426
NCBI-ProteinID: NP_001342973
PomBase: SPAC631.02
Position
I:2107940..2110123
AA seq 727 aa
MTPVQVPNLDVSVTSSLITTAPVTGNAATISTFTPGSPEPSMNGEEKESSYFPISENDDG
TLDLFGDSELEKEQKGDNQETDYSSQYLHPTPPYTNFDDESPSSPTHPSVSNITVDGDSK
KHSLQLQEEEKSSESLDSHTHPPKRVRNEDDSLTFSKTSPVSPSSLKDGASNTVTNDASN
KIKSEASESASPSALQALDSTAAGSSKEHSSPHDETVKKEENDKDQYPPMTKEQHKYIHA
MLRQLRRGRDSIPFRAPVDPVKQNIPDYPTIIKNPIDLGTMQKKFSSGVYSSAQHFIDDM
NLMFSNCFLYNGTESPVGVMGKNLQATFERQLKQLPSAYVTSYSRPGRRPRSMTAPKGGA
RTRRQAAMYSNSSSGIRETMYDLKPHRRKDAAEMKFCQSVLKELLKKQHEAYAYPFYKPV
NPTACGCPDYFKVIKHPMDLGTMQNKLNHNEYASMKAFEADMVLMFKNCYKFNSAGTPVH
LMGKKLESIFQKLWANKPDFDSETYMGMSSVNTDYYYGDNEVFDSGDEFLEDDGEEFEAV
NRQIHKLQSTLQAMKSRARSSSVSRRSRSRSLSVDIYPPITYEMQNELAEQCNYLSADQL
SHVAEILRAALPHLRNTDEIEIDVSAMPPDVFYKVYYYVCKGDEIGAEALATASHTHQEK
KKGRALSETEQAEKIRQLRAQLDRFSGIAQNKNTVTGNIAAYNTKSLGSDDSSSEDDGES
SESSDSA
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgacccccgttcaagtaccaaatttagacgtttcggtcacttcatctctcattactact
gcgcctgtaactggcaacgctgctaccatttccacatttactcctggatcacccgagcct
tctatgaatggtgaagaaaaggaatcatcttattttccaattagcgaaaatgatgatgga
accttagatctttttggtgactcagagttggagaaggagcagaaaggcgataatcaggag
actgattactcttctcaatatttgcatccgactccgccttatactaatttcgacgatgag
tctccatcatcccccactcatccctccgtgtcaaatatcactgttgacggtgactctaaa
aaacattctttgcagctgcaggaggaggaaaaatcctctgaatcgttggattctcatact
catcctcctaagcgtgtacgcaatgaagatgactccttaacattttcaaagacatcaccc
gtatcaccatcgtcgctgaaagatggtgcctcaaacaccgttaccaacgatgcgtctaat
aaaattaaatctgaagcttcagaatcggcatctccttctgctttacaggctctggactct
actgctgctggcagcagtaaggagcatagttcccctcacgatgagactgtaaaaaaagaa
gaaaatgataaggatcagtatccaccaatgacaaaagagcagcataaatatattcatgcc
atgcttcgccaactacgacgtggtcgtgactccattccgtttcgtgctcctgttgatcct
gtgaaacaaaatattccagattatcctaccattattaaaaacccaattgatcttggaacc
atgcagaagaagttttcttctggcgtttatagcagtgcacaacatttcattgatgatatg
aacttgatgttcagtaattgtttcctgtacaatggtactgagtcacctgtgggtgtaatg
ggtaaaaatctacaagctactttcgaacgacaattgaaacaactaccttctgcttatgtg
accagttattcccgtcctggccgtcgtccacgtagcatgactgcacctaaaggtggggcg
cgtacacgtcgacaagccgccatgtattctaattcttcatcaggaattcgtgagaccatg
tatgatttgaagccacaccgtcgcaaagatgcagctgaaatgaagttctgccaatctgtt
cttaaagaattgttgaagaagcagcacgaagcttatgcttatcctttttataaacctgtt
aatcctacagcatgcggttgtcctgattacttcaaagtaattaaacatcctatggatttg
ggtacgatgcaaaacaaattgaatcataacgaatatgcttcaatgaaagcttttgaagcc
gacatggttctcatgtttaaaaattgttataaatttaattctgctggtactcctgtgcac
cttatgggaaagaagcttgaatctatctttcagaaattatgggctaataaacccgacttt
gattcggagacctatatgggtatgtcttcagtgaacactgattattattacggagataat
gaagtttttgatagcggtgacgaatttttggaggatgatggtgaggagtttgaagcagtt
aatcgtcaaattcacaagctgcaaagtactttacaggccatgaaatctagagcacgttct
tcttcagtatctcgccgttcacgttctaggagtcttagcgttgacatttacccacctatt
acatatgaaatgcagaatgagctggctgaacagtgtaattacttatctgcagaccaactt
tcgcatgttgccgaaatattaagggccgcactacctcatttacgtaataccgatgagatt
gaaattgatgtgtcggcaatgccacctgatgtattttataaagtctattattatgtgtgc
aaaggtgatgagatcggagctgaagctttagctaccgcctctcatacccatcaagagaaa
aagaaaggacgagccctgtctgaaacggagcaggctgaaaaaatccggcagcttcgtgcc
caattagacagattttctggcattgctcaaaataagaatactgttacaggaaatattgct
gcttataatactaaatcgttaggcagtgatgattcttcctctgaagatgatggtgaaagc
agtgaaagtagcgattccgcatag

DBGET integrated database retrieval system