KEGG   Schizosaccharomyces pombe (fission yeast): SPAC637.04Help
Entry
SPAC637.04        CDS       T00076                                 

Definition
(RefSeq) putative cargo transport protein Ypp1
  KO
K21845  cargo-transport protein YPP1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPAC637.04
Membrane trafficking [BR:spo04131]
 Endocytosis
  Others
   EFR3-PI4KIII alpha complex and associated proteins
    SPAC637.04
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_2 TPR_17 TPR_19 TPR_11 TPR_1 DUF627 TPR_20 Trp_repressor Prenyltransf TPR_9
Motif
Other DBs
NCBI-GeneID: 2543221
NCBI-ProteinID: NP_594622
PomBase: SPAC637.04
UniProt: O94441
Position
I:join(4544074..4544082,4544122..4544233,4544290..4546757)
Genome map
AA seq 862 aa AA seqDB search
MFSAKAKTYELKLEQTRCNGDWQAIPEVARKLHKHNSSKSFVCELAKIEASLKSALTAEL
KNIANVLEPKLIDNQYSLIPALPSARTDPLLSQLNSLNIQNATEDEKLQETSIRLLLYIV
QRKFPEAVDLDWSPQGIPWTETSTGICILQATVLSSLAQYAQANDEVAYQYVRSAIGLIQ
NANIGKKPLPELTRWCDLAYSLYAQMSVSACSSQLERANILTTCLSYFTEHKSVNLLYKL
VTSRQAIKYLEHILRTNTNGSKIFTKSPVKNLYLNWPQLVLDYGSLLCNFTSFPKAGDQN
MFAVEFIELATSIWINTEKSYDITVSLIRMLYQLTGKCFQAQQIFRSLVFFLRHIEEFEE
ASEAFEIYKFLCVKSHERLARKNSDVAGSFSDIKPVFVDEPKSIIEVCSVMMTVYAQYLR
NLKKVSEILDYITKIASDYDLLKRDDIAPLIYHTEGVAYSFMYYQANNPSLRERYHQKSV
QSYQKCLEKQPTNTNALFHLAMQYSERRAITDAMQIVRRLLEVNPKYSIVSWHLLVLCVS
CSEQYAAGIKLIDSVFETWGINHVNEDGTIEISLTNLTFNDRCALVDLLITKLALFEAEK
GVEATLDIQDEIFTLFASIFDLNEYRISKEGSSDELSTLLERSTIQSIKSSKKISKDVEN
EKGSILGFSRKSSLKRSTVLSKKSHSSYKENFQLRRGKTVSYLNQKLWLTAASLFLKSGN
DDQARSALLEAKKIDHECAWVYYLNGLSLLQQGKEVEGYEQLDVAHYLDPEDPLISTALA
KCLLQGGYGPMHSRRNRADAILSSCTLQYGWDLPEAWYYTAEIFRQLGDLKQAAFSYDYC
IQLADTNPVRRWSNLQPRFMNV
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgttttccgctaaagcaaaaacctatgaactaaaactagaacaaacaagatgtaatgga
gattggcaggcaattcctgaggttgctagaaaattgcataagcataactcttcaaagtcc
ttcgtttgtgaattagcaaaaattgaagcttctcttaaatcagcattaactgctgaacta
aaaaatattgcaaacgttttggagcctaaattaatagataatcagtattccctaattccg
gctttacccagtgctcgtaccgaccctcttctaagtcaattaaactcattgaacattcaa
aatgccacagaagatgagaagcttcaggagacatccatacgcttgttattatacattgta
cagcgtaaatttcccgaagccgtagatttagattggtctcctcaaggaattccgtggact
gaaacttccactggtatatgcatcctacaagcaacagtgctatcatcgctagctcaatat
gctcaagctaacgatgaagttgcatatcaatacgttcgttcggccattggcttaattcaa
aatgccaatattggcaagaagcctttaccggaacttacaagatggtgcgatcttgcatat
tcattgtatgctcaaatgtctgtaagcgcttgttcgagtcaattagaaagagctaatata
cttactacatgcttgagctattttaccgagcataagtccgtgaatttgctttataaacta
gttaccagcagacaagctattaaatatttggaacatattttaagaactaatacaaatgga
tcaaaaatttttactaaaagtccggttaaaaatctttatttaaattggcctcaacttgtc
ctcgattatgggtctttgttatgtaactttacctcttttcctaaagctggtgatcaaaac
atgttcgccgttgaatttattgaacttgcaacatcaatatggataaacacagagaaatct
tacgatatcactgtcagcttgattcgaatgctttatcagcttactggaaaatgcttccaa
gcacaacaaatttttcgttctttggtattttttttaaggcatattgaggaatttgaagaa
gctagcgaggcttttgaaatttacaagtttctatgcgtaaaatctcacgaacggttagca
agaaaaaattcagatgtcgctggctctttttctgatatcaaaccagtgtttgttgatgaa
ccgaaaagtattattgaagtatgctccgttatgatgaccgtttatgcgcaatatcttcgt
aatttgaaaaaagtttctgaaatacttgattatattacaaaaattgcttctgattatgat
ttactgaaacgtgacgatattgctcctttaatttatcatacagaaggagttgcttattct
ttcatgtattatcaagctaacaacccttcgttaagggaaagatatcaccagaagagcgtc
caatcttaccagaaatgtctagaaaagcaaccaaccaatacaaatgcacttttccatttg
gctatgcaatattcggagagacgtgccattactgatgcaatgcaaattgttcggcgactt
cttgaggtgaaccctaagtacagtattgtatcttggcatcttttggttttgtgtgtgtct
tgttctgaacaatacgcagcaggaattaagctgatcgatagtgtatttgaaacttggggc
attaatcatgtcaatgaagatggcactattgagattagtttgacaaatttgacatttaat
gaccgctgcgctttggtcgatttattgattacgaaactagctctttttgaagccgaaaaa
ggcgtagaagctactctggatatccaggatgaaatatttacattatttgctagtattttt
gatttgaatgagtacaggatatcaaaggaaggatcgtcagatgaattatcaacgctttta
gaacgatcgactattcaatccattaaatcatccaagaaaatctctaaagatgtggaaaat
gaaaaaggaagtattcttgggttttccaggaaatcatcgcttaagagatctactgtttta
agcaaaaaatcccactcttcctataaagaaaattttcagttacgtcgtggtaaaaccgta
tcatatctcaatcagaagctttggcttaccgctgcatctcttttccttaaaagtggaaat
gatgatcaagcacgaagcgctttactagaagctaaaaaaatagaccatgaatgtgcttgg
gtgtactatttaaatggtttatctttactacaacagggaaaagaagttgaagggtatgag
caacttgacgttgctcattatttagacccggaggatcccttaatttcgacggcccttgca
aagtgtcttttacaaggtggctatgggcctatgcattctcgtagaaatagagcagatgct
attttatcgagctgtactttgcagtatggctgggatctaccagaagcttggtattatact
gcagaaatatttcgtcaactcggtgatttaaaacaagctgcgttttcgtatgattattgc
atccagctagctgatacaaaccctgtacgccgatggagtaacttgcagcctaggtttatg
aacgtttaa

DBGET integrated database retrieval system