KEGG   Schizosaccharomyces pombe (fission yeast): SPAC644.07
Entry
SPAC644.07        CDS       T00076                                 

Definition
(RefSeq) putative iron-sulfur protein assembly ATPase
  KO
K08900  mitochondrial chaperone BCS1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:spo03029]
    SPAC644.07
Mitochondrial biogenesis [BR:spo03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-III assembly factors
    SPAC644.07
SSDB
Motif
Pfam: BCS1_N AAA AAA_24 AAA_16 AAA_29 AAA_25 RuvB_N RNA_helicase T2SSE ATPase AAA_21 ABC_tran AAA_33 AAA_18 AAA_11
Other DBs
NCBI-GeneID: 2543663
NCBI-ProteinID: NP_593875
PomBase: SPAC644.07
UniProt: Q9P6Q3
Position
I:2686406..2687755
AA seq 449 aa
MDNIGAADAATSSGISGLLSGNSFLGAGIGLMGFGAGLAILRRGLISGASLVKRRMLVSV
EIPSKEKSYNAFLHWMSTVPKRYSNQLAVESNRQLKMPQNAREKPDKQVANRIFSLVPGP
GKHYIKYKKCWIQVERERSNRLQDLTTGTPWETITLTTLSRDRGIFSELLLEAQKFMQSA
QKNKTTIYTAWATEWKPFGHPRSKRMLSSVVLESNVKKMITDDVHDFLRNSQWYDTRGIP
YRRGYLLYGPPGSGKTSFLYALAGELDYDICVLNLAEKGLTDDRLNHLLSNVPPKAVVLL
EDVDSAFQGRERSGEVGFHANVTFSGLLNALDGVTSSDERIIFMTTNHPEKLDPALVRPG
RVDVKAYLGNATPEQVREMFTRFYGHSPEMADDLSDIVCPKNTSMASLQGLFVMNKSSPA
DAVDMAKELPDNPPSTPFSFNVHRKSLSV
NT seq 1350 nt   +upstreamnt  +downstreamnt
atggataatataggtgctgccgatgcagcgacgtcttctggcatttctgggttactaagt
ggaaattcatttttaggtgctggtattggtttaatgggtttcggtgctgggctagccata
ttacgtcgtgggcttatttcaggagcaagcttagtaaaaagaaggatgctagtgtctgtc
gaaattccaagcaaagaaaaaagttataatgcctttttgcattggatgagcacggtgcct
aaacgctattcaaatcagctggctgttgaaagcaacagacaactcaaaatgccgcaaaat
gctagggaaaaacctgacaagcaagttgcaaatcgtatattcagcctcgttccaggtcct
ggaaagcattacataaagtacaaaaagtgttggattcaagtagaacgagagcgtagcaat
cgtctgcaagatttaacaactggaacaccttgggagacaattactcttaccactctttca
agagatcgtggaattttttccgaacttttattagaagctcaaaaattcatgcaaagtgct
caaaaaaacaagactactatatacacggcttgggccactgaatggaagcctttcgggcac
cctagatcaaaaaggatgctttctagtgttgtacttgaaagcaatgttaaaaaaatgatt
acagacgacgttcatgactttttacgaaattcacaatggtatgatacaagaggaattcca
tatagaagaggctatcttctttatggacctcctggaagtggaaaaacctcatttttatat
gctcttgcaggtgaattggactacgacatatgcgttctaaacttggctgaaaaaggctta
actgacgatcgtctcaaccatctactttctaatgtacctcccaaggcagtagttttactg
gaggatgttgattctgcatttcaaggtagggaacgatctggggaagttgggtttcatgcc
aatgttacatttagtgggttgttaaatgcactcgacggtgtcacttcatcagacgaaagg
attatatttatgacaactaatcatcctgaaaagcttgatccagctctcgttcgtccgggc
cgcgttgacgttaaagcatatcttggaaatgctacacctgaacaagttcgcgaaatgttt
actcgcttttacggtcactccccagagatggctgacgatttaagtgatatagtgtgtcca
aaaaatacaagtatggcttcattgcagggtctttttgtaatgaataagagctcacctgct
gatgctgttgatatggctaaagagcttcctgataatcctcctagtacacctttctccttt
aacgtacacagaaagtctttgtctgtatga

DBGET integrated database retrieval system