KEGG   Schizosaccharomyces pombe (fission yeast): SPAC664.10
Entry
SPAC664.10        CDS       T00076                                 
Symbol
klp2
Name
(RefSeq) kinesin-like protein Klp2
  KO
K10405  kinesin family member C1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPAC664.10 (klp2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:spo04812]
    SPAC664.10 (klp2)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Centrosome formation proteins
   Spindle formation proteins
    SPAC664.10 (klp2)
Cytoskeleton proteins [BR:spo04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     SPAC664.10 (klp2)
SSDB
Motif
Pfam: Kinesin Microtub_bd Lzipper-MIP1 DUF5082
Other DBs
NCBI-GeneID: 2543360
NCBI-ProteinID: NP_593458
PomBase: SPAC664.10
Ensembl: SPAC664.10
UniProt: Q9US03
Position
I:1721899..1724902
AA seq 817 aa
MEEEGHKSLTSHLPQSSSSLSQSREIAKEFTSNIPPPTIKTNSSSSNILKPRLSLQNEVN
QLKPAKFPSKMLPPGSLASVKSSSLAKKARPFTASSNPRMPKSAHPISSRSVSASSHFGR
PASAVSSSLNSSDDVRSMSDESMESYNDEKSVNASALRTTEDRLRSMEMAYAQLSAKVIP
SPSKRPANYKFYEQRIAMLEESLEVERSRTSELQEQFSVALREKAEAEANKIVSQKGMES
LEIMLNSMKSENHQRMAMLEENHARVMETAELQHQAELQDFASNIEQKANSLIMEYKNEL
QSAEEHFSHKIKELTSENELKISRLQEEKDSLLKKVQEGASLAMQRVQNKHDLEKKRLQS
AIQPLQEENNSLKQQIEQLQRELASETVVKENLKSSLDQQSANVQKLESTNRALESTIKT
LEEDVYTMKNKIIELEGILKSANVERDGLVEKLIAEETLRRKLHNTIQELKGNIRVFCRV
RPPLGDGESAQIAFPDQNSEASTIEIVAQAPGSSLTGNGIKQYAFNFDRVFSPETTNEDV
FNELSQLIQSAMDGYNVCIFAYGQTGSGKTHTMSSNTGMIPSSVRMIYNRSTSLKERGWE
YRMEGQFLEIYNETIIDLLASGNEEEKGKKKLEIYHDTKAGRTTITNITSEPLDTPEQVT
WLLDQASKNRSVAATNANEHSSRSHSVFMLHLNGSNSTTGETCRSTLNLIDLAGSERLSS
SQSVGERLKETQAINKSLSCLGDVIHALGSGKEGTYIPYRNSKLTNLLQYSLGGNSKTLM
FVNISPLKQHVPETLCSLRFATKVNNTQIGTARKVTK
NT seq 2454 nt   +upstreamnt  +downstreamnt
atggaagaagaaggacataaaagtttaacttcgcatctacctcagtcctcgagttctttg
tcgcaaagtcgagaaattgctaaagaatttacgtctaatatacctcctccgactattaaa
actaattcatcttcatcaaatattctgaaacctcggttatcattgcaaaatgaagttaac
caactgaaacctgctaaatttcccagtaagatgttaccaccaggaagcttagcctcggtt
aaatcttctagtcttgcaaaaaaagccaggccttttaccgcgtcctctaatcccaggatg
cccaagtctgcacatcccatttcaagtcggtcagtgtctgcttcttctcattttggtaga
cctgccagtgctgtttcatccagtttaaatagtagcgatgatgtgagaagtatgtcagat
gaaagtatggaatcttataatgatgaaaagtctgttaatgccagcgccttaaggactaca
gaagaccggttgaggagtatggaaatggcttatgctcaattatcggctaaagttattcct
tcaccctcaaaaagaccagctaattacaaattttacgaacagagaattgctatgcttgaa
gaatcattagaagtcgagaggagtcgtacatcggagttacaagaacaattttcagtggct
ctgagagaaaaagctgaggcggaggctaataaaatcgtttctcaaaagggtatggagagt
ttggagataatgttaaactcaatgaaaagtgaaaatcatcagcgcatggccatgttggaa
gagaaccatgctcgggtgatggagacagctgagcttcagcatcaagcagaattacaggat
tttgcttccaatattgaacaaaaagcaaatagtttaatcatggagtacaaaaatgaattg
cagtctgccgaagaacacttttcacacaagattaaagagcttacttcagaaaatgaactc
aaaatttccagactacaagaggaaaaggattctttattaaagaaagttcaggagggcgct
tcgctggctatgcaacgtgtccaaaataagcatgatctagaaaaaaaaagactgcaatct
gcaattcaaccgcttcaggaagaaaataattctttgaaacagcagattgaacaattacaa
agagaacttgcttctgaaacagttgttaaggaaaatctgaaatcttcgttggaccaacaa
agtgccaacgttcagaagcttgaatctacaaatcgggctttagaaagcactatcaaaaca
cttgaagaagatgtttatactatgaaaaataagattatagaactagaaggcattttaaaa
tctgccaatgttgagagagacggtttagttgagaaactcatagctgaggaaactctgaga
agaaaactccataataccattcaagaacttaaaggtaacatacgcgttttttgtcgagtg
cgacctccccttggcgatggagaatcagcacaaatagcttttcctgatcaaaattccgaa
gctagtactatagagattgttgctcaagccccagggtcttcgttaacagggaacgggata
aaacagtatgcctttaatttcgatcgtgtattttcccctgaaacgactaatgaggatgta
tttaatgaactgtcacagttaattcaaagtgctatggacggatataatgtttgtatattc
gcttacggtcaaacaggttcaggcaagacgcatacgatgtcttcaaatacaggaatgatc
ccttcatctgtaagaatgatatacaatcgctctacttctttgaaagaacgaggttgggaa
tatcggatggaaggacaatttctagaaatatacaatgaaaccattattgaccttttagcc
tccggaaatgaagaagagaagggaaagaaaaaactggagatatatcatgacacgaaggcc
ggaaggacgactattaccaatataaccagcgaaccgttagacacacctgagcaggtaacc
tggttgttagatcaagcttcgaagaaccgttctgttgcggctaccaatgctaatgaacat
tcctcaagatcgcattcagtttttatgctacacttgaatggaagcaattctacgacaggt
gaaacatgcagaagtacgcttaatttgattgatctggctggatccgaaagactttcgagt
agccaaagtgtgggtgaacgtttgaaggaaacgcaggcaatcaacaaaagtttaagttgt
ttaggagatgtaatacatgctttgggaagtggaaaggaaggaacgtacattccgtatcga
aattccaagctgactaatttgttacaatattcgttgggaggaaatagtaaaactctcatg
tttgtcaatatttccccactaaaacagcatgttcccgaaacattatgcagtttgagattt
gcaacaaaggtaaataatactcaaattggcacagcacgcaaagtcacaaaatga

DBGET integrated database retrieval system