KEGG   Schizosaccharomyces pombe (fission yeast): SPAC664.14
Entry
SPAC664.14        CDS       T00076                                 

Gene name
amt2
Definition
(RefSeq) ammonium transporter Amt2
  KO
K03320  ammonium transporter, Amt family
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPAC664.14 (amt2)
Transporters [BR:spo02000]
 Other transporters
  Pores ion channels [TC:1]
   SPAC664.14 (amt2)
SSDB
Motif
Pfam: Ammonium_transp
Other DBs
NCBI-GeneID: 2543501
NCBI-ProteinID: NP_593462
PomBase: SPAC664.14
UniProt: Q9US00
Position
I:1731627..1733165
AA seq 512 aa
MSSVNSIPTATSTVYISVLPATATPSGGSGGNVLHEDLNKFYDYGNTSWILACTPLCLIM
VPGVAFFYSGLARRKNTLALIMLSMLGLCVSFFQWYFWGYSLAFSQTGTSGYIGNLRHFA
FIRTLADYSPGSNNIPELVFANFQGMFAAITVALFTGAAAERGRIGPMLIITFVWLTVVY
CPIACWIWNPNGWAFKFGVYDFAGGGPVEVGSGFAALAYTVCLGRRSKFVEEQFRPHSVL
NVVLGTSLLWFGWLGFNGGSAYGSNLRAAMAITNTNLAGAVAGLVWVIYDYIFRTRKWST
IGFCSGVVAGLVAATPCAGFVSPHASLAIGAITGLCCNWAIKLKSHMRIDDAMDIFAIHG
VAGFVGTFLNGLFAVDYIAAMDGIYVGENKIRGGWFDHHWRQLGLQMAYICAVGAYDFVV
TFIILFITDKIPYLQLRVSPDAEEIGVDADQIGEYAFDYIEERREYKHWKISPAGVPEEI
IISNGVAQPTGNVAAPGKILESTNPLELGLTI
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgtcgtcagtgaattcaattcccacagcaacttctactgtttatatttcagtactgcca
gctacagctacacctagtggtggtagtggtggaaatgttttgcacgaagatcttaataaa
ttttatgattatggaaacactagttggattttagcttgtactccattgtgtcttattatg
gtgcctggtgtggcttttttctactctggcttagcaagaaggaaaaatacattggctctt
atcatgctctctatgcttggtttatgtgttagttttttccaatggtatttctggggttat
tctcttgctttttctcaaactggaacctctggttatattggcaatcttcgtcattttgcc
tttattcgcacacttgccgattactctcctggtagcaataatattcccgagcttgtattt
gcaaattttcaaggaatgttcgccgcaattactgtagccctcttcactggtgccgccgct
gaaagaggtcgtattggtccaatgctcatcatcacatttgtgtggctcactgtcgtttat
tgtcccatagcgtgttggatttggaatccaaatggttgggcttttaaatttggtgtatac
gatttcgctggcggaggacctgtagaagttggatcaggatttgcagctttggcgtatacg
gtttgtttaggacgtcgatccaaatttgttgaggaacaatttcgccctcattctgtgctc
aatgttgtattgggaacatctctgctatggtttggttggcttggtttcaacggtggtagt
gcttacggctccaatctgcgagccgctatggcaatcaccaacacaaacttagcaggtgct
gtagctggtttagtatgggttatttacgactacatttttcgcactaggaaatggtcaacc
ataggtttttgttccggggttgttgccggtttggtggctgcaacgccttgtgctggtttt
gtgagtcctcatgcctctttggcaattggtgctattactggcttatgttgcaattgggcc
attaagttaaagtcacatatgcgcattgatgatgcgatggatattttcgctatccacggt
gttgcgggttttgtgggtacctttttgaatggtttgtttgccgttgattatatcgcagca
atggatggtatttatgttggtgaaaacaaaatcagaggtggttggtttgatcaccattgg
cgccaactaggcttgcaaatggcctatatttgtgctgttggtgcatacgactttgttgtc
acgtttatcattttattcattacggacaaaattccctaccttcaacttcgagtgagccct
gatgctgaagaaattggtgtggatgctgatcaaataggtgaatacgcgtttgattatatt
gaagaacgtcgtgaatataagcattggaagatttcccctgccggtgtacctgaagaaatc
attatttccaatggcgttgctcaacctactggaaatgtggctgctcccggcaagattcta
gaatcaacaaacccattggagcttggacttacgatctaa

DBGET integrated database retrieval system