KEGG   Schizosaccharomyces pombe (fission yeast): SPAC6B12.04c
Entry
SPAC6B12.04c      CDS       T00076                                 

Definition
(RefSeq) putative aminotransferase class I and II
  KO
K14264  kynurenine aminotransferase [EC:2.6.1.7]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00380  Tryptophan metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    SPAC6B12.04c
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spo01007]
    SPAC6B12.04c
Enzymes [BR:spo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.7  kynurenine---oxoglutarate transaminase
     SPAC6B12.04c
Amino acid related enzymes [BR:spo01007]
 Aminotransferase (transaminase)
  Class I
   SPAC6B12.04c
SSDB
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP PRD
Other DBs
NCBI-GeneID: 2543228
NCBI-ProteinID: NP_593759
PomBase: SPAC6B12.04c
UniProt: O14209
Position
I:complement(2416782..2418047)
AA seq 421 aa
MAFRGIRPSNKVAASRPDVWTLVNQATAECKVPPVSLSQGFFNYNPPKFVLDAAKKSIDE
VACNQYSHTRGRPSLRKALSEAYSPYFKRTLNPDTEIVVTAGANEGFFSVFAAFLNPGDE
VIVMEPFFDQYISNITMNGGVPVYVPIIPPEEGSVKPVSAGAWKLDMNKLRNAITEKTKM
IVINTPHNPLGKIFSEEELNEIADLVLKHNLLVVSDEVYDRLSFVPFVRLATLRPELFKH
VVTVGSGGKTFGCTGWRVGWLIGDESLIKYSAAAHTRICFAVNSPCQEALAIAFGEAEKH
NYYEEYKSSYKKRFEILAKAFDQLEIPYTIPDGSYYTMANFSKLKLPKDYPFPEEIANRP
RDFKLCYWILKEIGVATIPPTEFYTDEDAPVAENYLRFAFCKTFETLEEAARRLQKLKDY
F
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggccttcagaggtatacggccttctaacaaagtcgctgcaagccgtcctgatgtatgg
accctagtgaatcaagcaacagctgaatgtaaagttcctcctgtatcacttagtcaagga
tttttcaattataatccaccaaagtttgttttggatgctgccaagaagtctatcgacgag
gttgcttgcaatcaatactcacacactcgcggaaggccaagcttacgaaaagcgttatca
gaagcgtattctccctatttcaaacgtactttaaatccagacactgaaattgtagtaacg
gcaggtgcaaatgaagggttctttagtgtttttgcggcctttttaaacccaggagacgaa
gttatagttatggagccattttttgatcaatatatatctaatattaccatgaacggtgga
gttcctgtctatgtacctattatacctcctgaggaaggatcggtgaaaccggtatctgca
ggtgcttggaagctggatatgaacaagttaagaaatgctattacagaaaagacgaaaatg
atagtaattaatacacctcacaatcctctaggcaagatcttttcggaagaagaattgaat
gaaattgccgatttggtattaaagcacaatctattagtcgtgtctgatgaagtctatgac
cgtctttcctttgttccgttcgtcaggcttgctactcttcgtcctgaacttttcaaacat
gttgtaacagttggatctggcggaaaaacgtttggatgtacgggatggcgtgttggttgg
cttattggtgatgaaagcctaatcaaatattctgccgcagctcatactcgtatttgtttt
gctgtcaatagcccttgtcaagaggccttggccatagcctttggcgaagcagagaaacat
aattactatgaagagtataaatcttcgtacaaaaagcgttttgagattctagccaaggcg
tttgatcaattagagattccctacactataccagatggcagttattatacgatggcgaac
ttctccaaactcaaattacctaaggactatccatttccagaggaaatagccaatcgacct
agggatttcaagctttgttattggattttgaaggaaattggtgttgctacgatcccccct
accgaattctatacggatgaagatgcaccagttgcagagaattaccttcgctttgcattt
tgcaaaacttttgaaactttagaagaagcagctagaagattacagaagttgaaagactat
ttttag

DBGET integrated database retrieval system