KEGG   Schizosaccharomyces pombe (fission yeast): SPAC6B12.10cHelp
Entry
SPAC6B12.10c      CDS       T00076                                 

Gene name
spp1
Definition
(RefSeq) DNA primase catalytic subunit Spp1
  KO
K02684  DNA primase small subunit [EC:2.7.7.102]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03030  DNA replication
Module
spo_M00261  DNA polymerase alpha / primase complex
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SPAC6B12.10c (spp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spo03032]
    SPAC6B12.10c (spp1)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.102  DNA primase AEP
     SPAC6B12.10c (spp1)
DNA replication proteins [BR:spo03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase alpha / primase complex
    SPAC6B12.10c (spp1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-GeneID: 2543323
NCBI-ProteinID: NP_593765
PomBase: SPAC6B12.10c
UniProt: O14215
Position
I:complement(join(2429169..2430459,2430544..2430617))
Genome map
AA seq 454 aa AA seqDB search
MTVQIDELDDKDLDEIIANGTLDGAKQGAVDSETMIQYYRHLFPWKYLFQWLNHGPVVTN
DFAHREFAFTLPNDAYIRYLSFSNWEELKKEALNLCPSRFEVGPVYSANPRDRKTIRKST
FHPLKKELVFDIDMTDYDDVRTCCSKTNICEKCWPFITIAVQVLDICFHEDFGFKHILWV
YSGRRGIHAWICDEIACSLDDRSRRMIASYLQVVVGNPQGGVRLINNLKRPLHPHLTRSL
NILKSAFVKIVLEDQDPWASKEGAENLLKLLPDKDLASALRKKWEVDPERSSKNKWSDID
TVLASGSIASISPSVIAIAKQDIVLTYLYPRLDVEVSRHLNHLLKSPFCVHPGTSRVCVP
IDIERMDSFNPLKVPTVNDLLQELDKNSQNDNGHGPTMETNTTENQKDNARGQSNKGHGF
STSLNPYTLYFKSFSSQLFKETVGNKRKHENLEF
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgactgttcaaatcgatgaattggacgacaaagatttggatgagataattgcaaacgga
acacttgatggcgctaaacagggagctgtggattcagagacgatgattcaatattatcgc
catctttttccgtggaaatatttatttcaatggttaaatcatggtccggtagtcactaat
gattttgctcatcgggagttcgcgttcacacttcctaatgatgcttatattcgttattta
tctttttcaaattgggaagagttaaaaaaggaagctttaaatttatgcccaagccgattt
gaagttggacccgtttatagtgccaatcccagggacaggaaaacaataaggaagtcaaca
tttcatccgcttaaaaaggaactcgtttttgatatagatatgactgactacgatgatgta
cgaacctgctgctcaaaaacaaatatatgcgaaaaatgctggccatttattacgatcgca
gttcaagttttagatatttgttttcatgaggactttggatttaaacacatattgtgggta
tactctggtcgaagaggtattcacgcttggatttgtgacgaaattgcttgttctttagac
gatcggtctcgtagaatgattgccagttatttacaggttgtagtaggtaatcctcaaggt
ggcgtacgacttattaataacttaaaaagaccccttcacccacatttgactcgttctctc
aacattctcaaatcggcctttgtaaaaattgtccttgaagaccaagatccgtgggcttct
aaagaaggagccgaaaaccttttgaaattactaccagacaaggatttagcatctgctctt
cgtaaaaaatgggaggttgatcctgaacgatctagcaaaaataaatggtccgacattgac
actgtcttagcatctggttctattgcctctatatctccttcagtaattgcgattgccaag
caggacattgttttaacctatttgtatccaagattggatgttgaggtttctagacattta
aaccatttgctaaaatctccattttgcgtccaccccggaactagtcgtgtttgtgttccc
atagatatagagaggatggattcttttaatcctttgaaagtacccactgtgaatgatctt
ttgcaagagttggataaaaattcccaaaatgataacggccatggtccaacaatggaaact
aatacaacagaaaaccaaaaagataatgctaggggacaatcaaacaaggggcatggcttt
tcaacttctctcaatccttatacgctgtactttaaatcgttcagtagccagctttttaaa
gaaacagtaggaaataaaagaaaacatgagaatttggaattttaa

DBGET integrated database retrieval system