KEGG   Schizosaccharomyces pombe (fission yeast): SPAC6F12.03c
Entry
SPAC6F12.03c      CDS       T00076                                 

Gene name
fsv1
Definition
(RefSeq) SNARE Fsv1
  KO
K08501  syntaxin 8
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    SPAC6F12.03c (fsv1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPAC6F12.03c (fsv1)
Membrane trafficking [BR:spo04131]
 SNARE
  SNAP-25[C] (Qc)
   STX8
    SPAC6F12.03c (fsv1)
SSDB
Motif
Pfam: SNARE Crescentin CENP-F_leu_zip LMBR1 ATG17_like Vps5 DHR10 DUF745 BAR_3 MCU Fez1 Prominin DUF3053 Tropomyosin DUF4164 Golgin_A5 Syntaxin FH2 DUF5660
Other DBs
NCBI-GeneID: 2542946
NCBI-ProteinID: NP_593289
PomBase: SPAC6F12.03c
UniProt: O14222
Position
I:complement(1313721..1314464)
AA seq 247 aa
MSNLLLIIDSVSQKIRDRRKLEEFGQNPDEEIESSLKDVRQELQKLNEEQSRLEKNAQIP
EYRVRESEAFLIRMQRRLESAEEEFEKQRRASSIPADGTSAFSANPQVASTNNKLTPLPS
LQKTTSSSEGSDIEMEAMYPVDGNDPDPINVNVLAQMHQQMLNEQEESLGGIEASVQRQK
RMGYAMNTELSEQNVLLDNMNNDADRIERRFDHAKNRLNKVSRKAKQYPRCFIILLLCAL
LLLVASI
NT seq 744 nt   +upstreamnt  +downstreamnt
atgtcaaatttgcttctgatcattgactcggtttcacaaaaaataagagacaggaggaag
ttggaagagtttggacagaatcccgatgaagaaattgagtcttcattgaaagatgttcgg
caagaattgcaaaaacttaatgaggagcaatcgcgattagagaaaaatgcacaaatccca
gagtacagagtacgagaatccgaagcatttcttattagaatgcaaaggaggttagagtct
gctgaggaagagtttgagaagcagcggcgtgcatcctcaattcctgctgacggaacaagt
gccttttctgcaaacccgcaagttgcaagtacgaataataagttaactccccttccttct
ttacaaaaaacgacttcgagtagtgagggatctgatattgagatggaggccatgtatccg
gttgatggcaatgaccctgatcccataaacgtaaacgttttggctcaaatgcatcagcaa
atgctcaacgaacaagaagaatctttaggagggatcgaagcaagtgtccaaaggcaaaag
cggatgggatatgcaatgaatacagaattgtccgaacaaaatgttttactagataatatg
aataatgatgctgatcgaattgagaggaggtttgatcatgcaaaaaatcgattaaacaag
gtcagccgaaaggctaaacagtatcccagatgctttattattttgctcctttgtgcgttg
ttattacttgtggcttccatttag

DBGET integrated database retrieval system