KEGG   Schizosaccharomyces pombe (fission yeast): SPAC6F12.13c
Entry
SPAC6F12.13c      CDS       T00076                                 

Gene name
fps1
Definition
(RefSeq) geranyltranstransferase Fps1
  KO
K00787  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00900  Terpenoid backbone biosynthesis
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPAC6F12.13c (fps1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:spo01006]
    SPAC6F12.13c (fps1)
Enzymes [BR:spo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     SPAC6F12.13c (fps1)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     SPAC6F12.13c (fps1)
Prenyltransferases [BR:spo01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   SPAC6F12.13c (fps1)
SSDB
Motif
Pfam: polyprenyl_synt
Other DBs
NCBI-GeneID: 2542898
NCBI-ProteinID: NP_593299
PomBase: SPAC6F12.13c
UniProt: O14230
Position
I:complement(join(1338452..1339375,1339581..1339700))
AA seq 347 aa
MSAVDKRAKFESALPVFVDEIVNYLKTINIPDDVTEWYKNSLFHNTLGGKYNRGLSVIDS
YEILLGHPLDEAAYMKAAVLGWMVELLQSFFLIADDIMDASKTRRGQPCWYLMPGVGNIA
INDAFMVESAIYFLLKKHFRQESCYVDLIELFHDVTFQTELGQQLDLLTAPEDSVDLSKF
SLQKHSFIVIYKTAFYSFYLPVALAMHLAGVATPENLKCAQDILIILGKYFQVQDDYLDC
YGDPTVTGKIGTDILDNKCSWIINLALAKCTPEQRVILDDNYGRKDSESEKRVKAVFEEL
NIRGEFENYEESEVSEIKKLIDGVDESTGLKKSIFTTFLGKIYKRNK
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgtctgcagttgataaaagagcaaaattcgaatctgctttgccagtttttgttgatgaa
atcgtcaattatctcaaaactatcaatattcctgacgatgtcacagaatggtacaagaat
agtcttttccataacacattaggtggaaagtataatcgtggattatctgttattgacagt
tatgaaattcttcttggacatcctttggacgaagcagcgtacatgaaagcagctgttttg
ggatggatggtcgagttgcttcaatcttttttccttattgctgatgacattatggatgct
tccaagactagaaggggtcaaccatgttggtatttaatgcctggcgttggtaatattgct
attaatgacgcgtttatggtagaatctgctatttactttcttttgaaaaagcattttcgt
caagagtcatgctacgttgatctaattgaacttttccacgacgtaacttttcaaacggaa
ttagggcagcaactcgatttacttactgctcccgaagactccgtcgatctttcgaagttt
tctcttcaaaagcattctttcattgtaatttacaagactgcattttattccttttatttg
cctgtcgcattggcaatgcatctcgctggtgtagctactcctgagaacttgaaatgcgcc
caagacatccttattatccttggtaaatacttccaagttcaagatgattatttagattgc
tatggtgatcctacggtaactggtaaaattgggactgatattttagacaacaaatgttct
tggattatcaatcttgctctcgcaaagtgtactcctgaacaacgtgttattttggacgac
aattatggacgtaaagatagcgaaagcgaaaagagagttaaagctgtttttgaggaactc
aatatccgtggtgaattcgagaactatgaggaatcagaagtttctgaaatcaaaaagcta
attgatggagttgatgaatcaaccggtttgaaaaaatccatatttaccactttcttagga
aagatttacaaaagaaataagtaa

DBGET integrated database retrieval system