KEGG   Schizosaccharomyces pombe (fission yeast): SPAC6F12.14Help
Entry
SPAC6F12.14       CDS       T00076                                 

Gene name
cut23, apc8
Definition
(RefSeq) anaphase-promoting complex subunit Apc8
  KO
K03355  anaphase-promoting complex subunit 8
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04111  Cell cycle - yeast
spo04113  Meiosis - yeast
spo04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPAC6F12.14 (cut23)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    SPAC6F12.14 (cut23)
   04113 Meiosis - yeast
    SPAC6F12.14 (cut23)
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     SPAC6F12.14 (cut23)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    SPAC6F12.14 (cut23)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ANAPC8 TPR_1 TPR_2 TPR_8 TPR_14 TPR_7 TPR_12 TPR_16 TPR_11 TPR_19 ANAPC3 TPR_17 TPR_10 DUF3856 BTAD
Motif
Other DBs
NCBI-GeneID: 2542880
NCBI-ProteinID: NP_593300
PomBase: SPAC6F12.14
UniProt: O94556
Structure
PDB: 

Position
I:join(1340400..1340533,1340826..1341544,1341583..1342427)
Genome map
AA seq 565 aa AA seqDB search
MTVSLNTMMGVDGLEDQEQLREIRNCLLKCISECSERGLVYAVRWAAEMLNGMNPIEMEH
IPFSSTPTGEFDLDPDMANEKLLEVEEKNIYLLAKSYFDCKEFERAAYTLQNCKSSKSIF
LRLYSKYLAGEKKSEEENETLLNTNLTLSSTNREFYYISEVLESLHYQGNKDPYLLYLSG
VVYRKRKQDSKAIDFLKSCVLKAPFFWSAWLELSLSIDSLETLTTVVSQLPSTHIMTKIF
YVYASHELHQVNSSAYEKLAEAEIIFPNSRYLKTQRALLTYDSRDFDEAESLFENILTND
PYRLDDMDTYSNVLFVLENKSKLGFLAQVASSIDKFRPETCSIIGNYYSLLSEHEKAVTY
FKRALQLNRNYLSAWTLMGHEYVELKNTHAAIESYRLAVDVNRKDYRAWYGLGQTYEVLD
MHFYALYYFQRATALRPYDQRMWQALGNCYEKIDRPQEAIKSYKRALLGSQTNSSILVRL
GNLYEELQDLNSAASMYKQCIKTEETEISPETIKARIWLARWELGKKNYREAELYLSEVL
NGDLELEEAKALLRELRSRMEHSYD
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgtcgctgaatacaatgatgggagttgatggactcgaagaccaagaacaacta
cgagagattcgtaattgtcttttaaagtgtatttctgaatgctctgaaagaggtttagtt
tacgctgtacgatgggcagctgaaatgctcaatggaatgaatcctattgaaatggaacat
attccattttcatcgacccctactggagagttcgatttggatcctgatatggctaatgaa
aagctactagaggttgaggagaaaaatatttatttgcttgcaaagtcttatttcgattgt
aaagagtttgagagggcagcttatactttgcaaaactgcaaatcgtctaaatcgatattc
ctacgattgtatagtaagtacttggcaggtgaaaagaaaagtgaagaagaaaatgaaacc
ttattaaatacgaacctaacactatcatctacaaaccgagaattttattacatttctgaa
gttttggaaagtcttcattatcagggtaataaggatccttatttgttgtatttaagtgga
gttgtatatcgaaagagaaagcaggatagcaaagctatcgactttttaaaatcttgtgtc
ctcaaagctccatttttttggtctgcttggctagagttatcattaagcatagatagtttg
gaaacgttgacaacagttgtcagccagttaccttcaacccacattatgaccaaaattttt
tacgtctatgcatctcatgagcttcatcaagttaatagctctgcgtacgaaaaacttgct
gaagcggaaatcatcttccctaatagtcgttatctaaagactcagcgagcactactcaca
tatgacagtagagactttgacgaagctgagtcgcttttcgagaacatactaacaaatgac
ccatatcgtttagatgacatggatacttactctaatgtgttgtttgttttagaaaacaag
tcgaaactcgggtttttagcacaagtcgcttcttcaatagacaaatttcggcccgaaact
tgctctattattggcaattactacagcttactttctgagcatgaaaaagctgtaacttat
tttaagcgggctttgcagttgaatagaaattatctatctgcctggacactaatgggacat
gaatatgtagaattgaaaaatacacatgctgctatcgaatcttacaggttagcagttgat
gttaatagaaaagattacagagcgtggtatggtttaggacaaacttatgaggttttagat
atgcatttttatgcactttactactttcaacgagctactgctttacgcccttatgatcaa
agaatgtggcaggctttgggaaactgttatgaaaaaattgatcgtccacaggaagcaata
aaatcctataaacgtgctttattaggatcccaaactaacagttcaattctagtccgtttg
ggtaatctttatgaggaactacaagatttgaattctgccgcttctatgtataagcaatgt
attaaaactgaagaaacggagatttctccagaaacaatcaaagcacgaatttggctcgca
aggtgggagcttggtaaaaaaaattacagagaagctgagctttatttaagcgaagtatta
aatggagacttagagttggaggaagccaaagctttgcttcgcgaattgcgtagtaggatg
gagcattcatatgattaa

DBGET integrated database retrieval system