KEGG   Schizosaccharomyces pombe (fission yeast): SPAC6F6.01Help
Entry
SPAC6F6.01        CDS       T00076                                 

Gene name
cch1
Definition
(RefSeq) calcium channel Cch1
  KO
K21864  voltage-dependent calcium channel
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPAC6F6.01 (cch1)
Transporters [BR:spo02000]
 Other Transporters
  Pores ion channels [TC:1]
   SPAC6F6.01 (cch1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ion_trans GPHH
Motif
Other DBs
NCBI-GeneID: 2542812
NCBI-ProteinID: NP_593894
PomBase: SPAC6F6.01
UniProt: O14234
Position
I:2726719..2732283
Genome map
AA seq 1854 aa AA seqDB search
MSSSSNSDPSSSPDNTDFIPLKDNPKDTSSYINKKNPFVNDSFDSHDDSYLDNVNPFEYN
VADDEDTISMTSDGVEFHNLGITETVDEQDKILSELQLAYPTVSRYSETLDKGLLNGDKT
TKGDYTSLRRFRKPFLFDKLSPYFTHFFSEIYAAVLRVVGPPRANETPGRNLPFSPILRQ
IYNHPLYNIFIFVVIVLHAVLLMIRSDDPHDKSQTIDYLIIVIGILYTLEMLLKIYLFGF
LYDGSSSFYDFINSYTKKTPRTMSYLRHSWNRVDFVAIVALWISVIGKKQQGIFRLFSMI
ACLRLTRLLNITRKTETILKSLKESSTPLVQVVSFNAFFGVMIAILGVQFFKASLNRQCV
WLGDYGDQYLPTGQFCGGHWENGIKRAYLDKNGFPSNVNPRGFICAEKSVCRVVENPYSN
TVSFDNFFNSLELIFVIMSSNGFTDIMYDIMDAEYFVSCLLFIISAYFLTLWLMSLVIAV
VTSSFIDLQHSGKNQKEQKSVDKHLIRNKLCEKYLFYSNFIWISFIVAQFVTLCTQTYDQ
TSSTANRYLIFYACVDFLLAAEVILRFFAYLPDYRLFFRRYTNLVDIVLAVLNLVTLLPS
IRKNPVAFGWLSIFAIARIYRCILLIPYTRKIAKLLFSNFKQLLNLMLFLVIVLFIASLC
AVRLFQDLPNDGDSDDDAISFATTYESFLYMYQILTSENWTDVMFAIQARLAHLHLSWIP
GAFFTLWFLFSNNVVLSMFIAVIQVNFAPSESDLKMEQLKMYLARLLRNYNPFQASLTLN
ALIKRNGSRKGKTVDESHYEWLYEDNIIKGFLRVTNIPPKEPLKPSLDTSPELSKYSLAK
LSNNFKRFVMRDDPFSQAYFKRVIGIRWEKDMNLKTAAKDMQAAKAFVRIKQTEFLKNHP
KYNDVFWVIKPSNRIRRFCQRLVMPGVNERYGGVEPYQWVYRVIQVFIYACILTAVIIEC
IATPIYERDHLLNDKQHAWFVWTEVAFATIFTIEAAIKIIADGFCITPNAYLRSTWNCID
FFVLVTLWINLYAVLTSHALLSRAFRAFKALRVLRLINLTQTSQRMFHDALISGFFKIFS
AAVVSATLLIPFALWAKNVFGGLLYSCNDDNVLSASQCVLEYASTPNNWEVWAPRVWSNP
PDYDFDRFPHALLALFEIASIEGWVDIMRSVMDITGFNNQPQTNASSGNAMFFVLFNLVS
MIYILTLFIAIIISNYAERTGSAFFTAEQRAWLELRRKIKSMRPSKRPAIRPLGLRGLCY
DFAVQKHGIWRRTFTGLYIVHLLFLLTIFYPCPIAYTYVRNSIFLILSICYTINICVKVY
GLSFYYFFHSFWNMFDVVVTLGSLTCNIAILAKFENRSLTLLQTTLLVLVTVHLIPKFDN
FDQLSKTVVASLPSIFSLIATWIVLYITFAIAFNQIFGLTKLGLNGGPNKNFRSIRNALV
LLFTMTFGEGWNDVMHDYTISYPNCVNGDDFYNSDCGNKPWAYGLFIAWNIISMYIFVNM
FITVVFDNFSYIHTKSSSFTNLQRNDFRQFKDSWAPFDPMVTGYIPKRNAVKFVLSLRGV
YDFRIYRDEHTLRSIISKVQSKTGQQSVPMLENPLMGSEINLEALDQIIDTIDVNVVKER
RNVLNSLCTEIMTLPGNVISFSNILMLVVLHKIVDHREAFPISDYIRRAYVLSELEKSIR
MEKLLGLVETSIIRKTFLQHMEEKKKALENPFILLSEVSEILPETPIQEVLRQHNADPEQ
LLMSTRTPSVSDRSFSIVESTVPTIASGEGDDNHSVEDHLKVPTDNEPRRSPSLKEVLLR
GSHSLHSNNDRTSFDIEAGFGTAESDFQFGGATEDINRIADRIDDYLDRDSFKG
NT seq 5565 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaagctcaaactcagatccaagctctagccctgataataccgatttcattccc
cttaaagataatcctaaagatacctcttcctacataaataaaaaaaatccattcgtaaac
gattcttttgattcccatgatgattcctatttggataatgttaacccatttgagtataat
gttgcagatgatgaagatacgatttccatgaccagcgacggtgtcgaatttcataacctt
ggcataaccgaaactgttgatgagcaggacaaaatcttgtctgaacttcaattggcctat
cctactgtttctaggtactcagaaacactagataaaggtcttctgaatggagataaaact
accaagggagattacaccagtctaaggagatttagaaaacctttcttgtttgataaacta
tctccttattttactcattttttttccgaaatttacgctgcggttttgagagttgttggc
cctccaagagctaatgaaacacccggaagaaacttgccattttccccaattctccgccaa
atttataatcaccctttatacaatatctttatttttgttgtaattgtgctacatgcggtt
ttactaatgattcgttctgatgaccctcatgataagtctcaaactatcgattatttaatt
attgtaatcggtatcttatatacgttagagatgttgctcaaaatctatttatttggtttt
ttatatgatggttcctcttcattttatgatttcataaactcgtataccaagaaaactccc
agaacaatgtcttatttgcgacattcatggaatcgtgtcgattttgtggctattgttgct
ttatggatctctgtaattggtaaaaaacagcaaggtatttttcggctttttagtatgatt
gcttgtttgcgcctaactcggctgttgaatataactcgaaaaactgaaaccatcctaaaa
agtttaaaagagtcgtctacacctttagtacaagtcgtctcgtttaatgctttctttggg
gtaatgatagctatattgggtgttcaattttttaaggcatcactgaatcgtcaatgcgta
tggcttggtgattacggggaccagtatttacctactggtcaattttgtggtggtcattgg
gagaatggtataaaaagggcttacttagataaaaatggatttccatccaacgtgaacccc
agaggttttatctgtgctgaaaaaagtgtttgtcgcgtggtggaaaacccctacagtaac
actgttagctttgacaattttttcaattctttggaattgatatttgttataatgagttcc
aatgggttcacggatattatgtacgatatcatggatgcagaatattttgtttcttgtctc
cttttcataatatctgcatattttcttacactctggctcatgtcccttgtgattgcagtg
gtaacgagttcttttattgacttgcagcattccggaaagaatcaaaaagaacaaaaatct
gttgataaacatctcattcgaaataagttatgtgagaagtacctattttactcgaacttt
atttggataagttttatagtagcccagtttgtaactctttgtactcaaacatatgatcaa
acttctagcactgcaaataggtacctaatcttttacgcttgtgtggactttctactggct
gcagaagtgattcttagattttttgcatacttgccagattataggcttttttttcgacgg
tatacaaatttggttgatattgtcttggccgttttgaatttggttactttattaccgagt
attagaaaaaatcctgtagcttttggttggttgtcaatatttgctattgctaggatatac
cgatgcattcttttgattccctatacacggaaaattgctaaactcttgttctcaaatttt
aaacaactgctaaatttgatgctatttttggtaatcgtcttattcattgcatctttgtgc
gctgtcaggttgtttcaagatttgcccaatgacggagattcagacgatgatgcgattagc
ttcgctactacttacgaatcgtttttatacatgtaccagattttgacaagtgagaattgg
acggatgtgatgtttgcaatccaagctcgattagcacatcttcacttatcgtggattcct
ggagctttttttactctttggtttctcttttcaaacaacgtggttttaagtatgtttatt
gctgtcattcaggtaaactttgcaccttcagaatctgatctaaaaatggaacaattgaaa
atgtacttagctaggttattaaggaactataatccttttcaagcttcccttactttgaat
gccttaattaaaaggaatggatctcgaaaagggaagacagtggatgaatctcattatgag
tggttatatgaagacaatattattaaaggctttttgcgtgttactaatattcctcctaaa
gagccacttaaaccgagtttggatacctcacccgagttatctaaatattcactggcaaag
ctgtcaaataactttaagagatttgttatgcgtgatgaccctttttctcaagcatacttc
aaacgtgttatcggtatacgctgggaaaaggatatgaatctcaagactgcagcgaaagat
atgcaagctgctaaagcatttgtccgaattaagcagaccgaatttttaaagaatcaccca
aagtataatgatgtgttttgggtcattaaaccgtcgaatagaattaggaggttttgtcaa
cgactggtaatgcccggtgtgaatgaacgatatggcggtgttgagccatatcaatgggtt
taccgtgtaatacaagtttttatttatgcttgtattctaactgcagtgattattgaatgc
attgctacacctatttatgagcgagaccatttattgaatgataaacaacatgcatggttt
gtatggacagaggtagcttttgcaactatttttacaattgaagccgctataaaaataata
gctgatggattttgtattacaccaaatgcataccttcgaagtacttggaattgcatcgac
tttttcgttttggttaccttatggatcaatctttatgcagtattaacaagccatgccttg
ctttcccgagcctttcgagcattcaaagcgcttcgtgtgcttcgattaatcaatcttaca
caaacttcacagcggatgtttcatgacgccctaattagtggtttttttaaaatattttct
gccgccgttgtgtcggcaacgttgctaattccttttgctctgtgggctaaaaacgttttt
ggtggattattatacagttgtaatgatgacaacgttttatcagcttctcagtgtgtttta
gaatacgcatccactcctaataattgggaggtttgggcaccaagagtctggtccaatccc
cctgattacgattttgatagatttcctcatgctctactcgctttgttcgaaatcgcctca
attgaaggatgggtagacattatgcgttcggtaatggacattactggattcaataatcaa
ccccagaccaatgcctcttctggtaatgctatgttctttgtgttgttcaaccttgtttca
atgatttatatattgactctttttattgccatcatcatcagcaattatgctgaacgtaca
gggtcggctttctttactgcggaacagcgcgcgtggttggaactgcgcaggaagataaaa
tcaatgcgtccgtcgaaaaggccggccattagacctctgggtttaagaggactttgttac
gactttgcagtgcaaaaacatggcatatggagaaggacatttactgggttgtatattgtg
catctcttgttccttctaaccattttttatccttgtcctatagcgtacacttatgttcga
aactctatatttctaatactgtcaatatgttatacgataaacatatgtgtcaaagtttac
ggtctttcattctactatttttttcacagtttttggaatatgtttgatgtcgttgtaaca
ttaggaagtctcacttgcaatattgctatccttgcaaagtttgaaaataggtcgttaaca
ctcctgcaaactactttattggtgttagttactgtgcatctaattccgaagtttgacaat
tttgatcagctttctaaaactgtggttgcaagcttaccttctattttttcattgattgcg
acatggattgttttatacattacctttgctatagcgtttaatcagattttcgggttgacc
aagcttgggttgaatggagggcctaacaaaaactttaggtcaatacgcaatgctcttgtt
ttgctttttacgatgacctttggagaaggctggaacgatgtaatgcatgattatactata
tcatatcctaattgtgtgaatggtgacgatttctacaattcagactgcggtaacaaaccg
tgggcttatggattgtttattgcttggaatattatctcaatgtacatttttgttaatatg
tttattactgttgttttcgacaacttttcctacatccatactaaatcttcctcgtttaca
aatttgcagcgtaacgatttccgacaatttaaggattcatgggcaccttttgaccccatg
gtcaccggttatattcccaaacgcaatgctgtaaaatttgttctttcgctaaggggtgtc
tatgatttcagaatatatcgagatgaacatacattgagaagcattatctccaaagttcag
agtaaaactgggcagcaatctgtcccaatgctcgaaaatcccttgatgggttctgaaata
aacttagaggcgctagaccaaattattgatactattgatgtaaacgtagtgaaagagcga
agaaacgtactgaattctctctgtacagagattatgacactaccgggcaacgtcatttct
ttttcgaatatattgatgttagttgtacttcataaaattgttgatcatcgtgaagcattt
cctatttctgactacattcgccgagcgtacgtactttcggaattggaaaaatctattaga
atggaaaagttgttgggtttggttgaaacttcaatcatcagaaaaacattccttcaacat
atggaagaaaagaagaaagctttagaaaatcctttcatacttttgagtgaagtttctgag
attttacccgaaacacccattcaagaagtccttcgccaacataatgctgatccagagcaa
cttttaatgtcaactagaacaccttcagttagtgatcgcagtttctccatcgttgaatcg
actgtaccgacaatcgcttcgggtgaaggtgatgataaccatagcgtggaagatcatttg
aaggtaccaactgataatgaacctcgaagatcaccttctctcaaagaagtccttcttcgt
ggatctcattctttacattcaaataacgaccgaacttcatttgacatcgaagcaggattt
ggaactgctgaaagcgatttccaatttggcggagcgacagaagatatcaatcgcatagct
gaccgtatagatgattatttagatcgggattcatttaaaggataa

DBGET integrated database retrieval system