KEGG   Schizosaccharomyces pombe (fission yeast): SPAC6G10.02c
Entry
SPAC6G10.02c      CDS       T00076                                 

Gene name
tea3
Definition
(RefSeq) cell end marker Tea3
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Kelch_4 Kelch_1 Kelch_3 Kelch_6 Kelch_5 Kelch_2 HALZ CENP-F_leu_zip
Other DBs
NCBI-GeneID: 2542619
NCBI-ProteinID: NP_594099
PomBase: SPAC6G10.02c
UniProt: O14248
Position
I:complement(3214690..3218067)
AA seq 1125 aa
MVQKVLSRQSDNSQDVSAEQLDVVESGSIDQQNIRAWVVRKVKENDKRTSTNQSFKWEAV
KPASCLDAANEKFMYLHGGREKSGISNSLFKLDLDSCTVYSHNRGEDNDSPARVGHSIVC
SADTIYLFGGCDSETDSTFEVGDNSLYAYNFKSNQWNLVSTQSPLPSPRTGHSMLLVDSK
LWIFGGECQGKYLNDIHLFDTKGVDRRTQSELKQKANANNVEKANMEFDETDWSWETPFL
HSSSPPPRSNHSVTLVQGKIFVHGGHNDTGPLSDLWLFDLETLSWTEVRSIGRFPGPREG
HQATTIDDTVYIYGGRDNKGLILNELWAFNYSQQRWSLVSNPIPILLSDSSSYKIVSKNN
HILLLYLNALDAPKQLLCYEADPKNLYWDKDKFSDIPVLQHISMKPSNASNHTVSLGYLN
DRPNHSKKNSVTSTSSSQFNNFLEQNQKAVRSARHRHYASLDEQGLHSLRNLSKTSGMNH
SADFSLHEFGQADPFAYEIEKPIASLPLPNGNDTISRSSESSSPINESESNSLLKLQSDF
KFSNSDDRVAWLEEQLLYCMQQGYTLKPPNLFQHVDEKLRLEKKEQLSYLEILKVIEQML
ESNEQKFKKQIVSLASENAKLAAQRDAAVENANYSRSLIQKKTTDETVGSLIEKVGKLEY
EVQGTLEEATSYYQKNTELQQLLKQNESASELLKSRNEKLCVDYDKLRSVFEEDSSKILS
LQKENENLQSQILQISEELVDYRSRCEALEYGNYELETKLIEMHDRVEMQTNVIEASASA
LDVSNTAILSFEDSLRRERDEKSTLQQKCLNLQYEYENVRIELENLQSRALELESALEQS
VSDAKYSKAIMQSGLSKLLSSINENKDNLKEFSKSKQKISYLESQLEGLHELLRESQRLC
EGRTKELLNSQQKLYDLKHSYSSVMTEKSKLSDQVNDLTEQAKITQRKLSEVQIALADSK
MNQQLSGKDSTDVHLPTDFSASSSPLRSYFNEEDSFNNASAAHSSKESDIPSGGVFTKYR
NHFGNLMTSEETKAPDNNDLHKRLSDVINSQQKFLSLSPQVSKDYYDVRSKLNDTAGSFS
GEEMRAIDDNYYASRIKQLEDDYQKAITYANCSDESFQQLSHSFM
NT seq 3378 nt   +upstreamnt  +downstreamnt
atggttcaaaaggttttaagccgtcaatcggataactctcaggatgtgtctgctgaacag
cttgatgtagtggaatccggtagcattgatcagcaaaatatacgtgcatgggttgttcgc
aaagtcaaagaaaatgataaaaggacatctacgaaccaaagttttaaatgggaagctgta
aaaccggcttcttgtctagatgctgcgaatgaaaaattcatgtacttacatggaggacga
gaaaaatctggtatttcaaactctttgtttaagttggacctggattcatgcacggtttat
tctcacaatagaggggaagacaatgattctcctgctcgagttggtcattctatcgtttgt
tctgctgacactatttatcttttcggaggatgcgactcagaaacagattccacatttgaa
gttggcgataattcattgtacgcatacaatttcaagagtaatcaatggaatttggtttca
acacagtcccccttaccatcgcctcgcactggacattctatgttgttagttgactctaaa
ttatggatatttgggggtgaatgtcaaggaaaatatttgaatgatatacatttgtttgat
accaaaggggttgatcggaggacgcaatcagaactcaagcaaaaggcaaatgcaaataat
gttgaaaaggctaatatggaatttgatgagactgattggtcatgggaaacaccgtttttg
catagctcatcccctccacctcgttcaaatcactcagttactcttgtccaaggaaaaata
tttgtacatggagggcataatgatactggtccattaagtgatctttggctttttgattta
gaaacactttcatggaccgaggttcgttctataggaagatttccaggtccgcgggaaggt
catcaagctactacaatagatgacacggtttacatttatggtggtcgtgataataaaggg
ttgatactcaacgagctttgggcttttaattatagtcaacagcggtggtccttagtctca
aatccgatccctattttgctttctgattcatcttcatacaaaattgtttcaaaaaacaat
catattttactattatatcttaatgcacttgacgctcctaagcaactgttatgttatgaa
gcagatcccaaaaatttgtattgggataaggataaattttctgatattcctgttcttcag
catattagcatgaaaccttcaaatgcttcaaaccacacggtttctcttggttacctaaac
gaccgtcctaatcattccaaaaagaattctgtgacatccacctcgtctagtcaatttaac
aattttttggagcaaaatcaaaaagccgtaagatcagctaggcatcggcactatgctagc
ttggatgaacaaggattacattctttgagaaaccttagtaaaacctctggaatgaatcat
tcagcagatttctctcttcacgagtttgggcaagctgacccctttgcttacgaaattgag
aaacctattgcgtctcttcctttacctaatggaaacgatactatttctaggtcttccgaa
tcttcatctccaatcaacgaaagtgaaagtaattctctgcttaaactccaatcagatttt
aagttttctaattctgatgatcgtgtagcttggcttgaggagcaactgttatattgtatg
caacaaggctatactctcaaacctcctaacctgtttcaacacgttgatgaaaaattgagg
cttgagaaaaaagagcagctcagttatttggaaatactgaaggtgattgagcaaatgctt
gaatctaatgaacaaaagtttaaaaagcaaatcgttagcctagcatctgaaaacgcaaaa
ttggctgctcagagagatgctgccgtggaaaatgcaaattattcacgttcactgatccag
aaaaagacaacggacgaaactgttggatctttaatagaaaaagttggaaagttagagtac
gaagttcaagggactcttgaagaggcaacctcttattatcaaaaaaatactgaacttcaa
cagttattgaagcaaaatgaatccgcttctgaactcttaaaatctcgaaatgagaaactt
tgtgtagattatgataaacttcgtagtgtgtttgaagaagattcatcaaaaatactatct
ttacaaaaagaaaatgaaaacctacaatcacagatattgcaaatttcagaagagttagtc
gattatcgttctcgttgcgaggctttggagtatggaaattatgagctggaaacgaagcta
attgagatgcatgatcgagtggagatgcagacaaatgtgattgaagcatccgctagtgct
cttgatgtgtccaatactgccatattgtcttttgaagattcgctccgtagagaaagggat
gagaaaagtacgttgcaacagaagtgcttaaatttacagtacgaatatgagaatgttcgg
attgagttggaaaatttgcaatctcgtgcgctagagttggagtcagccttagaacaatca
gtgtctgatgctaaatactcgaaagctataatgcaaagcggattatcaaagttattatct
tctattaacgaaaataaagataatcttaaagagttttcgaagtcgaaacaaaagatctcc
tacttggagtctcagctagaagggcttcacgagttgttacgtgagtcccagagactttgt
gagggtcgcactaaagagctactaaattctcagcaaaagctctatgatctaaagcattca
tattcctctgtaatgacagagaaaagtaaactttctgatcaggtcaatgatcttaccgag
caagcaaaaattactcagcgtaagctctctgaggtacaaattgcattggctgattcaaaa
atgaatcaacagttatcaggaaaggactctactgacgttcatcttcctacggacttttca
gcttcctcctctcccttaagatcatactttaacgaagaggattcattcaataatgctagt
gctgcacatagttcaaaagaatctgacataccttctggtggtgtgtttacaaaatatcgt
aatcattttggtaatttgatgacatctgaagaaacaaaagccccggataacaatgattta
cataaaagactttctgatgttatcaacagtcagcaaaaatttttgtctttgtcccctcag
gtatctaaagattattatgatgttcgctcaaaactaaatgataccgcgggctcattttca
ggtgaagaaatgcgtgcaattgatgataattactatgccagtcgtattaagcaactggag
gatgattatcaaaaagccataacatatgccaattgctcagatgagtcatttcagcagctt
agtcattcatttatgtaa

DBGET integrated database retrieval system