KEGG   Schizosaccharomyces pombe (fission yeast): SPAC6G10.03c
Entry
SPAC6G10.03c      CDS       T00076                                 

Definition
(RefSeq) cardiolipin-specific deacylase
  KO
K13535  cardiolipin-specific phospholipase [EC:3.1.1.-]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SPAC6G10.03c
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     SPAC6G10.03c
SSDB
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 Esterase Abhydrolase_3 PGAP1 Ser_hydrolase LIDHydrolase DUF915 Ndr Peptidase_S9 DUF2920 Abhydrolase_5 Lipase_3 UPF0227 Chlorophyllase2
Other DBs
NCBI-GeneID: 2542281
NCBI-ProteinID: NP_594100
PomBase: SPAC6G10.03c
UniProt: O14249
Position
I:complement(3218952..3220238)
AA seq 428 aa
MSQVKVAVRSEEAANSYTQTFGMSWRQWRQACSEEYAKQCEREVLHTVDFIRENEKDPER
LVEVVDSKIYDNDGLVHEVCVSDKATGKANKRSIVYMHGYGAGLGFYFRNMDGLTKGVTK
DFNSYFVDWLGMGNSSRPPFDIKGQTASEKVEETERFFTESLETWRIGHGIEKMILVGHS
MGGYLSAVYAMQYPERVEKLLLVSPVAIPENPFASNDDAEVYNSVASSAVHAVMDEPPLS
NVTNEVLQTQEETTGLEPSRPSKPKNPLPRFITFLWEQNVTPFSLLRLSGPLGPKLMSFW
SSRRFSTLPPETFRALHNYCYSIFRLKGSSEYALGNLLAPGAFARRCIMNRLRMLKCRTI
FMYGDKDWMDDVAGLEATNRLKEMNIEAEHHIISNAGHHCYLDNPEDFNEIVLKEIRMSL
RSFSSISE
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgagccaagtgaaagtcgcggtgagaagtgaggaagcagctaattcttatacgcaaacg
tttggcatgtcctggaggcaatggcgtcaagcatgctctgaagaatatgcgaaacaatgt
gagcgtgaagtcctgcacactgtcgattttattcgggaaaatgaaaaggacccagaaagg
ttagttgaagttgtagattccaaaatctacgataatgatggattggtacatgaggtttgt
gttagtgataaagcaacaggaaaagcgaacaagcgaagcattgtttacatgcatgggtat
ggagctggtcttggtttttactttcggaacatggatggtttgactaagggtgtgacaaag
gattttaattcttattttgttgattggctaggcatgggaaactcgtcaagaccgcctttc
gatatcaaggggcaaaccgcttcagagaaggtcgaagaaacagagaggtttttcactgag
tcattagaaacatggagaatcggtcatggtatcgagaaaatgatccttgtgggccatagt
atgggaggttatttgtctgctgtctacgccatgcaatatccggaacgtgttgagaaactc
ttactagttagtccagttgccattcctgaaaacccttttgcaagcaacgatgatgcggaa
gtttacaattccgttgcttcctctgctgtgcatgctgttatggatgaacctcctttaagt
aatgttactaatgaggttctgcaaacccaagaggaaactacaggtttagagccttcccgg
ccaagcaagccaaagaatcctcttccaagatttatcaccttcttatgggagcaaaatgtt
acaccattttctctacttcgtttaagcgggcctttaggtcctaaactaatgagtttttgg
tctagcagaaggttttcaacgcttcccccggaaacgtttagggcattacataattactgc
tactcaatatttcgtctcaagggttccagcgagtatgcacttggcaatttgctcgctccc
ggagctttcgctagacgatgtattatgaatcgcttgcgcatgttgaagtgtcgaactata
ttcatgtatggagataaagattggatggatgatgttgctggtttagaagcgacaaacaga
ttgaaggagatgaatattgaggcggagcaccacataatttcaaatgctggtcaccattgc
tatcttgataaccctgaagattttaatgagattgtactaaaggagatacgaatgagttta
cgttctttttcttcgatttcagagtaa

DBGET integrated database retrieval system