KEGG   Schizosaccharomyces pombe (fission yeast): SPAC6G10.11cHelp
Entry
SPAC6G10.11c      CDS       T00076                                 

Gene name
ubi3
Definition
(RefSeq) ubiquitin-40S ribosomal protein S31 fusion protein
  KO
K02977  small subunit ribosomal protein S27Ae
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03010  Ribosome
Module
spo_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SPAC6G10.11c (ubi3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:spo03011]
    SPAC6G10.11c (ubi3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPAC6G10.11c (ubi3)
Ribosome [BR:spo03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    SPAC6G10.11c (ubi3)
  Archaea
    SPAC6G10.11c (ubi3)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SPAC6G10.11c (ubi3)
  Exosomal proteins of colorectal cancer cells
   SPAC6G10.11c (ubi3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 Rad60-SLD_2 Ubiquitin_5 TBK1_ULD DUF2407 DZR DUF2318 TF_Zn_Ribbon Cytochrome_C7 Zn_Tnp_IS1595 Zn_ribbon_SprT DUF4925
Motif
Other DBs
NCBI-GeneID: 2541445
NCBI-ProteinID: NP_594108
PomBase: SPAC6G10.11c SPBC337.08c
UniProt: P0C016
Structure
PDB: 

Position
I:complement(3237910..3238362)
Genome map
AA seq 150 aa AA seqDB search
MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGGKKRKKKTYTTPKKIKHKHKKVELAVLKYYKVEDDGSVKRLRRE
CPNCGASTFMANHKDRLYCGRCHLTLKLEN
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgcagatctttgtaaaaacccttacgggtaagaccattacccttgaggttgaatcctct
gacactattgacaatgtcaagagcaaaatccaagataaggaaggaattcctcctgatcaa
caacgtttgatctttgctggcaagcaactcgaggacggacgtactttgtctgattataac
atccaaaaggagtccactcttcacctcgttttgcgtcttcgtggtggtggtaagaagcgt
aaaaagaagacttacactactcccaagaagatcaagcacaagcacaagaaggttgagctc
gccgtcctcaaatactacaaggttgaggatgatggaagcgttaagcgtcttcgtcgtgag
tgtcccaactgtggtgcgtccaccttcatggccaaccacaaggaccgcctttactgtggt
agatgccatttgactcttaagttggaaaactaa

DBGET integrated database retrieval system