KEGG   Schizosaccharomyces pombe (fission yeast): SPAC6G9.08
Entry
SPAC6G9.08        CDS       T00076                                 
Symbol
ubp6
Name
(RefSeq) ubiquitin hydrolase Ubp6
  KO
K11843  ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:spo01002]
    SPAC6G9.08 (ubp6)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:spo04121]
    SPAC6G9.08 (ubp6)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SPAC6G9.08 (ubp6)
Peptidases and inhibitors [BR:spo01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   SPAC6G9.08 (ubp6)
Ubiquitin system [BR:spo04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    SPAC6G9.08 (ubp6)
SSDB
Motif
Pfam: UCH ubiquitin UCH_1 Rad60-SLD
Other DBs
NCBI-GeneID: 2541819
NCBI-ProteinID: NP_594117
PomBase: SPAC6G9.08
Ensembl: SPAC6G9.08
UniProt: Q92353
Position
I:3259564..3262222
AA seq 468 aa
MMIPIAIRWQGKKYDLEIEPNETGSTLKHQLYSLTQVPPERQKVIVKGGQLKDDVLLGSV
GIKPNATLLMMGTAGELPTAMPIPAVESVEQEESEDDGYPSGLINLGNTCYMNSTVQMLR
AIPELSDAVSQFNSSGGLVAEYRTLLNSMQSNAPVTPMRFLQSLRMEYPQFAEMSRETGG
YAQQDAEECWSFLLSVLQRSLSSEWVQKNMAGKLLSTMKCDENEVQEQPSISHDTFLSLP
CHISMHTSYMTQGILEGLTQKISKHSDVLNRDAMYSKISRISRLPNYLTVNFVRFYWKAS
IGKKAKILRKVKFPFELDAVEFCTPELSQKLIPVRDKLREIEKNDEEHERAAKRIKIQPS
EDEKEAEAECRLTQVATCQSLVDPELADDEGANPTGLYDLVGVLSHAGASASSGHYQAWI
RNSNNRAEWFRFNDAKVSIVPAEKIETLDGGGEADSAYILLYKAKDIA
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgatgattcccatagcaattcgttggcaagggaagaagtacgacttagagattgaacct
aatgaaacaggaagcaccttgaaacatcaactatactcgttgacacaagttcctccggaa
cgacagaaagtgattgtcaaaggtggccagcttaaagacgatgttttgcttggttcagtt
ggtattaaaccaaatgcaactttattaatgatgggtactgcaggcgaactaccaacagct
atgcccattccagctgtcgagtcagtagaacaagaggaatctgaagatgatggctatccg
tcagggcttataaacttaggcaacacgtgttacatgaattctacagttcaaatgctgcgt
gccattccagaattatcagacgctgtctcacaattcaattcctctgggggtttggtggca
gaatatcggacgttattaaattctatgcaatctaatgctccggttacaccaatgaggttt
cttcaaagtctacgcatggagtatccacagtttgcagaaatgagtagagaaactgggggt
tatgctcaacaggatgctgaggaatgctggtcattcttgctatcagttttacagcgctcc
ctatcatctgagtgggtacaaaaaaatatggctggaaaacttttatctactatgaaatgt
gatgaaaacgaagtacaggagcaaccctctatttcacatgatacgtttttgagtttacct
tgccatatctctatgcatacaagctatatgacccaggggatccttgaagggcttacgcaa
aaaatttctaagcatagtgatgtattaaatcgtgatgccatgtatagcaaaatctcaagg
atttctcgactacccaattatttaactgttaattttgttcgattttactggaaagcatca
atagggaaaaaggctaaaattcttcgtaaggttaagtttccatttgagctcgatgcagtc
gagttttgtactcctgaactttcacaaaaattgattcccgtacgtgacaaattacgtgaa
attgaaaaaaatgatgaagaacatgagcgagctgctaagcgtatcaaaattcaaccttca
gaggacgagaaggaggcggaagctgagtgcaggcttactcaggttgcgacgtgtcaatca
ctagtagatcctgagctcgctgatgatgaaggagccaaccccaccggcctttatgattta
gtcggggttttatcacacgccggtgctagtgcatcttcaggccattaccaagcttggata
agaaatagcaataatcgtgctgaatggttcaggttcaatgacgcaaaggtatctatcgtt
cctgctgaaaaaattgaaactctcgatggtggtggtgaagctgacagtgcctacatcctt
ctttataaggcaaaagacattgcatga

DBGET integrated database retrieval system