KEGG   Schizosaccharomyces pombe (fission yeast): SPAC6G9.11
Entry
SPAC6G9.11        CDS       T00076                                 

Symbol
syb1
Name
(RefSeq) synaptobrevin family receptor
  KO
K08513  vesicle-associated membrane protein 4
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    SPAC6G9.11 (syb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPAC6G9.11 (syb1)
Membrane trafficking [BR:spo04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    SPAC6G9.11 (syb1)
SSDB
Motif
Pfam: Synaptobrevin
Other DBs
NCBI-GeneID: 2541731
NCBI-ProteinID: NP_594120
PomBase: SPAC6G9.11
UniProt: Q92356
Position
I:join(3268311..3268512,3268577..3268740)
AA seq 121 aa
MSEPYDPYIPAEPSAAVRSGNAAASSTPNMKTAAIQQQIDDTVGIMRENISKVSERGERL
DSLQDKTDNLAVSAQGFRRGANRVRKKMWWKDMRMRLCIIIGIIILLVVIIVPIATKFHG
K
NT seq 366 nt   +upstreamnt  +downstreamnt
atgtctgagccatatgacccatatatcccggcggagccttctgcagctgttcgtagtgga
aatgctgctgcttcgtcgacgccgaatatgaagacagctgcaattcagcagcagattgac
gatactgtggggattatgcgtgaaaacatttctaaggtttcagaacgtggagaacgcctt
gattctttacaagataaaacagataaccttgctgttagcgcgcaaggcttccgtcgtggc
gccaatcgtgttcgcaagaagatgtggtggaaggacatgcgtatgcgtctttgcattatc
attggtatcatcattttacttgttgtcattattgttcctatcgcaacaaaatttcatggc
aagtaa

DBGET integrated database retrieval system