KEGG   Schizosaccharomyces pombe (fission yeast): SPAC7D4.04
Entry
SPAC7D4.04        CDS       T00076                                 
Symbol
taf1
Name
(RefSeq) autophagy-associated protein taf1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Atg11_middle ATG11 ATG17_like LAGLIDADG_WhiA Pox_polyA_pol DUF3700
Other DBs
NCBI-GeneID: 2541735
NCBI-ProteinID: NP_593855
PomBase: SPAC7D4.04
Ensembl: SPAC7D4.04
UniProt: O14261
Position
I:complement(2630448..2633728)
AA seq 926 aa
MRFRLNDSFSGKSWTIDNVQWTPQNLVAWIMELNIGLSDEAKLLLPNGMSLNETVLNSES
DVVIYVLDQNLLTFTYDGDKIPSIPSLKGQPISNVLTGIIADSSSDQWKDKISKCLSLLS
DILESSSKIHNQLSVCHDEYSTSIVSPEVAMNYLQRRQSGMKDLLFVFYERLDRVSVSDL
LHDFLALPTGSLPITPLKILSTNWTKLDSWLNSISARYAEAQKRVQQCIGAANSIIVSPF
KEVPSIKEGDDAYYHLRSVAQDAANILQEILKIESTSTTSQIKPKCNYETEITDCMEKLQ
SNLSELKSSRKSSLISLKSFWLSFYKVSLRYDALYEYLRQIAEELDRSKFVLSQSRNIFS
LYIDILMEALRRTEWQESYNVSHDSSLPLDQEKELSLRKSWLSHFSNLLFNHGQLKYLPV
LTRDEISNYLLNIQAHPNYQTFHQMLSNRLSEYLGFPGSPREAVSNTVQANNSLHEKLAM
YQNRCNNLEAMLSHQNGFNYNINNDGLSPNAPHPPINEQSNSSQPFYRVSPSIVPLNVIR
KLTNRKTSFTDSHILRLQDEVNQLRNELDLVNKRNEDLLIELQGKEEKIQYLETENEEVL
QKYENLQEELSSTRKLLTKNEAAVAEQQSNEEMHSNEPNILNLYSVFEGKVDSLQELYNA
FKLQLTSLKQKGEYATLAKDAEAVQHIIEERDYALAEKADLLKLSENRKEQCKILTQKLY
TIVFRCNELQSVLRECVTQPGFDSDNERDGHASIPDRQIEFNSKDLQYLYWMDGEDADRN
FQEFLNRMSSLDFDSFHNFVVSVLTQAHNHELRWKREFQSNRDKALKAILDSQSKVSLRN
FKQGSLVLFLPTRRTAGNKKVWAAFNVNAPHYYLNTQPHLKLESRDWMLGRVTSIEDRTA
DDSTDKWLRLPSGTIWHLVEAIDERF
NT seq 2781 nt   +upstreamnt  +downstreamnt
atgcgttttcgattgaatgattcattctccggaaagagttggaccatagataatgtacaa
tggactccccaaaatcttgtagcttggattatggagctcaatattggacttagtgatgaa
gcaaaactattattgccgaacggaatgtctttgaatgaaaccgtactaaatagtgaaagt
gatgtggttatttacgtactagatcaaaacttgttgactttcacctacgatggtgataaa
attccttctattccttctctgaaaggacaaccaatatctaatgtacttactgggattata
gctgattcttcttcagatcaatggaaagataaaatcagcaagtgtctttcattattatct
gatattttagagtcttcttcaaagattcataatcaattaagcgtatgccatgatgagtat
tctactagtattgtttctccagaagttgcaatgaattatttacaaagaagacaatctggt
atgaaagatttacttttcgttttctacgaaagactagatcgagtatctgtgtctgattta
cttcatgatttcctcgctctaccaactggttctttacccattactcctcttaaaatactt
tcaacaaattggactaaattggactcctggttaaactccatttcagctcgttatgctgaa
gctcaaaaacgagtccaacagtgcattggcgccgcaaatagtattatcgtttccccattc
aaggaagttccttcaatcaaggaaggagatgatgcttattatcatctacgttccgtcgct
caggatgcagccaatatattgcaagagatccttaaaatagagtcaacttcaactacttct
caaatcaaaccaaaatgtaattacgaaaccgaaattactgattgcatggaaaaacttcaa
agtaatctgtcggaattaaaaagttctagaaagtcatcactaatatctttgaaatctttt
tggctttccttttataaggtttctcttagatatgatgcattgtacgaatatcttcgacaa
atagcagaagagcttgacagaagcaaattcgttctttctcagtctcgaaacattttttcg
ctatatatcgacattttaatggaggcactgaggaggactgaatggcaggaatcatacaat
gtaagccatgatagttctcttcctttagaccaggagaaggagctttctcttaggaagtct
tggctcagtcatttctctaatttgctttttaatcatggccagctaaagtacttaccagtt
ttaactcgtgacgaaatttctaattatttactcaatattcaagcacatccgaattaccaa
acttttcatcaaatgctaagcaatcggctctcagaatatttgggctttcctggaagtcct
cgagaagccgtttccaatacggttcaagcgaacaattcattacatgaaaaattggcaatg
tatcaaaatcgttgcaataatttagaggcaatgttaagccatcaaaacggctttaattat
aacattaacaatgatggtttatctccaaatgctccacatccacccatcaatgagcagtct
aattcttctcagccattttaccgtgtttcccctagtattgtgcctctaaacgtaattcgt
aaattaactaatcgcaaaacttcttttaccgacagccacatattacgacttcaagatgag
gttaatcaattacgcaacgaattagatttggtaaataaaagaaatgaggacttattaatt
gagcttcaagggaaggaagaaaagatccaatacctcgaaactgaaaatgaggaagtgcta
caaaaatacgaaaatttacaggaggaactttcatcaacacggaaactgcttacgaaaaat
gaagcggcagttgcagaacagcaatcaaacgaggagatgcattctaatgaaccgaacata
ttaaacctttactccgtatttgagggcaaagttgatagcttgcaagaactttataatgct
ttcaagcttcaactcacgagtttgaagcaaaagggcgaatacgctactcttgcaaaagat
gccgaagcagtacaacatattattgaagagagagattatgctcttgcagagaaagctgat
ttactcaaactttccgagaatcgaaaagaacaatgtaagatattaactcagaaactttat
accattgtattccggtgtaatgagttacagtctgttcttcgggaatgcgttactcagcct
ggatttgattcagataacgaaagagatggccatgcatcgattccagatcgccaaattgaa
tttaattccaaagatttacagtatctttattggatggatggggaggatgctgataggaat
ttccaggaatttttgaacagaatgagttctttagattttgactctttccataactttgtt
gtcagtgttttgactcaagcacataatcatgaacttcgttggaaacgtgaatttcaatct
aacagggacaaggcgctgaaagctattttggactctcaaagtaaagtctcattaaggaat
ttcaaacaaggatccttggtcttgtttttgcctactcgacgtaccgccggtaacaaaaag
gtgtgggcggcttttaatgttaacgctcctcattattatttgaacactcaaccgcatttg
aaacttgaaagccgcgactggatgttaggaagggtaacttccattgaagatcgtactgct
gatgattcgacggataaatggcttcgcctgccttcaggtacaatatggcatttagtggaa
gctatcgatgaaagattttaa

DBGET integrated database retrieval system