KEGG   Schizosaccharomyces pombe (fission yeast): SPAC823.08c
Entry
SPAC823.08c       CDS       T00076                                 

Definition
(RefSeq) putative ATP-dependent RNA helicase Rrp3
  KO
K14777  ATP-dependent RNA helicase DDX47/RRP3 [EC:3.6.4.13]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spo03009]
    SPAC823.08c
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     SPAC823.08c
Ribosome biogenesis [BR:spo03009]
 Eukaryotic type
  90S particles
   Helicases
    SPAC823.08c
SSDB
Motif
Pfam: DEAD Helicase_C ResIII AAA_30
Other DBs
NCBI-GeneID: 2543571
NCBI-ProteinID: NP_593835
PomBase: SPAC823.08c
UniProt: Q9P6N8
Position
I:complement(2592647..2594044)
AA seq 465 aa
MAPSEKKLTEDKKNSSLNKKIETSNSSSEKSSENNNGDSQNNEAPKTFKELGVIDELCEA
CEKLGFKTPTPIQQEAIPVVLNKRDVIGLAQTGSGKTAAFALPVIQELWNNPSPFFAVVL
APTRELAYQISEQFEAIGGSIGVRSVVIVGGMDMVTQAVALSKKPHVLVCTPGRLMDHLE
NTKGFSLKNLKYLIMDEADRLLDMDFGPIIDKILKIIPHERRTLLFSATMTSKVEKLQRA
SLHQPVRVAVSSKFSTVDTLIQRYLFFPFKHKDTYLVYLVNELAGNSIIIFARTVNDTQR
LAILLRTLGFSAIPLHGQLSQSNRLGALNKFKSGARSTLVATDVAARGLDIPLVDVVINY
DIPTDSKAYIHRVGRTARAGRAGKSIALVTQYDLEPFLRIEATIGKKMQEYEIDKEGVFL
LSERVGEAQREAIIQMKEIHDRRKSKGKLHTKRKRDDLDREEQIY
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggcaccttctgagaaaaaacttactgaggataaaaaaaattcctcattgaataaaaag
attgaaacatctaattcaagctctgaaaaatcttcggaaaataataatggtgactcacaa
aacaacgaagcccctaaaacttttaaggaattaggagtaattgacgaattatgcgaagct
tgtgaaaaactgggatttaaaactccaactccgattcaacaagaagccattccagttgta
ttgaataaacgagatgttataggtctagctcaaactggtagtggtaaaactgcagcattt
gcgctgcctgtcattcaagaattgtggaacaatccgagcccattttttgcagtcgtgctt
gctccaactcgagaacttgcctatcaaatatctgaacaattcgaggctataggaggtagt
atcggcgttcgcagtgttgtaattgttggtggtatggatatggtaactcaagcagtcgct
ttatcaaaaaagcctcatgtcctagtttgtacacccggacgtctgatggatcatttggag
aacacgaaaggttttagtttaaagaatttgaaatatttaatcatggatgaagccgatcgt
cttcttgatatggattttggtccaattattgataaaattcttaaaattattcctcatgaa
agacgtactttgttattttctgctactatgactagcaaggttgaaaagcttcagcgtgca
tcccttcaccaacccgtgcgtgttgctgtatcttccaagtttagtaccgtcgatacccta
atacaacggtatttgttttttccatttaaacacaaggacacgtatctcgtttacttggta
aatgaacttgccggcaattcaattatcatattcgctcgtacagtaaacgatactcaacgg
ttggccatattattacgtaccttaggattttctgctattcctttacatggacagttgtct
caaagtaatcgtcttggggctttaaataaatttaagtcaggtgcgagatctactcttgtt
gcaactgatgtcgctgccagaggtctagatatacctcttgttgatgtagtaattaattac
gacattcctaccgactcaaaggcatatattcatagagttggtcgtaccgctcgagcaggt
cgggcaggtaaatctattgcattggttactcagtatgatttagaaccttttcttcgaatt
gaagctacaattggcaaaaaaatgcaggaatatgaaattgacaaggagggtgtatttctt
ttatctgaacgtgttggagaagctcaacgtgaagctattattcaaatgaaggagattcac
gataggagaaaatcaaagggaaaattgcacacgaagcgcaaacgtgatgatcttgatcgt
gaagaacaaatctattaa

DBGET integrated database retrieval system