KEGG   Schizosaccharomyces pombe (fission yeast): SPAC823.16c
Entry
SPAC823.16c       CDS       T00076                                 
Symbol
mug179
Name
(RefSeq) WD repeat-containing protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: ANAPC4_WD40 WD40 eIF2A
Other DBs
NCBI-GeneID: 2543297
NCBI-ProteinID: NP_593843
PomBase: SPAC823.16c
Ensembl: SPAC823.16c
UniProt: Q9P6N1
Position
I:complement(2609181..2611001)
AA seq 335 aa
MPSIILYCSWNQDRGFLSIGSENGYQVYRSNPFTLCFSKKANGASICEMLYESSLLAFVN
ISPESTRLLKLVDIKRDIVLCRIFYPSPVLSVRFTWNRLVVLIKGSIYVYNLKNMELINT
LNTSKGNVIAFAVHENYVAYNSPTNPGDIYLASLDTAIPVTLIHCHSSAVQVVDFHPRGH
LIATASAKGTVIRVITTSDGELVTELRRGYIPASIVSISFHPVEPFLACASENGTIHVFK
ISKQPSDPNSSPTSSVTVSSSWSKYLTSNVAKVWDTRKEFATAKIPEASFYGKIIFSSSG
PHIQVASYSGHYYRFAVNLKNGGNCALLERYIFDD
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgccatcgattatcctttactgttcgtggaatcaagatcgtggctttttatcaattggt
tctgagaatggctatcaagtttatcgctccaatccgtttaccctgtgcttttcaaaaaaa
gccaatggggcaagtatttgtgaaatgctttatgaatcttctctacttgctttcgtgaat
atttcccctgagtcgacgaggttactaaaattggttgacatcaagagagatatcgtttta
tgccgaatattttatccgagtcctgtgctaagtgtacgtttcacatggaatcgtttagtt
gttttaattaaagggagtatttacgtatataatctaaaaaacatggaattaattaatact
ctaaatacctcgaaaggaaatgttatagcttttgctgttcatgagaattatgttgcatat
aattcaccgaccaaccctggtgatatttatttagcctcattggatactgcaatacccgtc
acattgattcattgccattcttccgctgtccaagtagttgactttcatccgcgtggacat
ttgattgcgactgcatccgcaaagggaactgtaatccgtgttataacaactagtgatggt
gaattggtgacagaattgcgcaggggatatatacctgcatccattgtatctatctcattt
cacccagttgagccttttctggcttgtgcttctgaaaatggtactattcacgttttcaaa
atctctaagcaaccatcggatccgaattcgtctcctacatcttccgtaactgtgtcatct
tcttggtcaaaatatttaacttcaaatgtagcaaaagtttgggacactaggaaagaattt
gcaactgctaagattcctgaagcttctttctatggaaaaataattttttcgagcagcggt
ccgcacatacaagtagcttcttattcaggacactattatcggttcgcagtaaatcttaaa
aatggaggaaattgtgctttacttgagcgttacatctttgacgattaa

DBGET integrated database retrieval system