KEGG   Schizosaccharomyces pombe (fission yeast): SPAC869.06c
Entry
SPAC869.06c       CDS       T00076                                 

Definition
(RefSeq) putative cation-binding HHE domain-containing protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Hemerythrin PET122 Borrelia_orfA
Other DBs
NCBI-GeneID: 2543135
NCBI-ProteinID: NP_595013
PomBase: SPAC869.06c
UniProt: Q9URY9
Position
I:5502575..5503186
AA seq 203 aa
MLQYSKKKVSLNFFPVRLLSYKMTRISDAIFKDHRKLQSDYQNIKSANDYDTATRWQNQF
VWELARHSVGEEIVVYPKFEKYLGEEGKEMAEKDRHEHQLVKEMLYKFQSMKANQSNFIP
ALDELMESLQKHIDEEEQHDIPFLEKHLSEEESLHMASSFERTKKFVPTHSHPSAPNKPP
FETVAGLFAAPIDKLRDMMEKWP
NT seq 612 nt   +upstreamnt  +downstreamnt
atgcttcagtattccaagaaaaaagttagtctcaattttttccctgtaagactattaagt
tacaagatgacaagaatttcagatgctatttttaaagatcataggaaattgcaaagcgat
taccaaaatataaagtcggcaaacgactatgatactgctactagatggcaaaaccaattt
gtttgggaacttgcaagacattcggtcggagaggaaattgttgtttatcccaagttcgaa
aagtaccttggcgaggaagggaaagaaatggcggagaaagacagacacgaacaccaatta
gttaaggaaatgctatataaatttcaatcaatgaaggctaaccagagtaattttattccc
gctttggatgagctaatggaatctcttcagaaacatattgacgaggaggagcaacatgat
attccctttttggaaaagcatcttagcgaagaagagtcattacatatggcatcttctttt
gaaagaacaaagaagtttgttcctacgcatagccatccttctgctccaaataaacctccc
ttcgaaaccgtcgcaggactttttgctgcacccattgataaacttcgtgacatgatggag
aaatggccttaa

DBGET integrated database retrieval system