KEGG   Schizosaccharomyces pombe (fission yeast): SPAC869.07c
Entry
SPAC869.07c       CDS       T00076                                 

Gene name
mel1
Definition
(RefSeq) melibiase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00052  Galactose metabolism
spo00561  Glycerolipid metabolism
spo00600  Sphingolipid metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SPAC869.07c (mel1)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SPAC869.07c (mel1)
   00600 Sphingolipid metabolism
    SPAC869.07c (mel1)
  09107 Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    SPAC869.07c (mel1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SPAC869.07c (mel1)
SSDB
Motif
Pfam: Melibiase_2 Melibiase_C Melibiase Melibiase_2_C
Other DBs
NCBI-GeneID: 2543243
NCBI-ProteinID: NP_595012
PomBase: SPAC869.07c
UniProt: Q9URZ0
Position
I:5499782..5501092
AA seq 436 aa
MISISFLNCFFLVFLFLFFSDVHGSYNGLGLKPQMGWNSWNKYACDIDESIILNNAKAIK
EEGLLDLGYEYIVMDDCWSKHERNATTGRLEANPDKFPNGIGSMAKKLHDMGFKFGMYSS
AGKYTCAGFPGSLNHEQIDADTFADWGVDYLKYDNCFNEGKSGVPLISYERYKRMSDALN
KTGRPIFYSLCQWGEDFVWNWGNTIANSWRISGDIFDTFSRKDVRCPCETIECFALQGDH
CSVMNIISKASFLSSKAGMNSGWNDLDSLEVGNGGMSFEEYKTHFTMWAILKSPLILGND
VSSMSPMDKLIVSNKELISINQDIGTNPAALIWKKKYGDEYIELFSGRLSNNDWVVAVLN
AASEPLKMGIHLSDIFVDALGNAEHDWLATDLWNNNVKLVSDRIRANVASHGVQVWRFQQ
YKVKNTNDKFFSFNKH
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgatatccatttcatttttaaattgcttttttttggtattcctttttttgtttttctca
gatgttcatggtagctataatggtttgggactaaaacctcaaatggggtggaattcttgg
aataaatatgcctgtgatatcgatgagtctataatccttaataatgccaaggctataaaa
gaggaaggacttcttgacttaggttatgagtatatagtaatggatgactgttggagcaag
catgagcggaatgcaaccactggtagattggaagcaaatcctgataaattccccaacgga
attggttcaatggcaaaaaaattacatgacatggggtttaaatttggaatgtactcaagt
gcagggaaatatacatgtgctggatttcctggatcattaaaccatgagcaaattgatgct
gatacatttgcagattggggagtagattacttaaagtatgacaattgcttcaacgaaggg
aaaagcggcgttcccttgattagctatgaacgttacaagcgaatgtctgatgctctaaac
aaaactggaagaccaattttttactctttatgccaatggggtgaagattttgtttggaat
tggggaaatacaatagctaactcttggaggataagtggagatatctttgatacatttagt
cgtaaggatgtgcgttgtccgtgcgagacaatcgaatgttttgcgcttcagggagatcat
tgttcagtaatgaatattattagtaaagcatcgtttcttagttctaaagcaggtatgaac
agtggatggaacgatcttgattcgttagaggttggaaatggaggtatgagctttgaggag
tataaaactcatttcacaatgtgggcaatactaaaatctccccttatacttggtaacgat
gtcagtagcatgtctcctatggataagttaattgtatccaacaaagagttaatttctata
aatcaagatattggtacaaatcctgctgctcttatttggaaaaaaaaatacggtgacgaa
tatatagagcttttttctggaaggctttccaataatgattgggtagtggctgttctgaat
gctgccagtgaacctctcaaaatgggcattcatttatctgatatatttgttgatgcattg
ggtaacgccgagcacgattggcttgctactgatttgtggaataataatgttaaacttgtt
tccgatcgcataagagctaatgttgcttcacatggcgttcaggtgtggaggtttcagcaa
tacaaagtgaaaaacacaaacgacaaatttttttctttcaataaacactaa

DBGET integrated database retrieval system