KEGG   Schizosaccharomyces pombe (fission yeast): SPAC869.11
Entry
SPAC869.11        CDS       T00076                                 

Gene name
cat1
Definition
(RefSeq) cationic amino acid transporter Cat1
  KO
K16261  yeast amino acid transporter
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPAC869.11 (cat1)
Transporters [BR:spo02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   SPAC869.11 (cat1)
SSDB
Motif
Pfam: AA_permease AA_permease_2
Other DBs
NCBI-GeneID: 2543573
NCBI-ProteinID: NP_595008
PomBase: SPAC869.11
UniProt: Q9URZ4
Position
I:complement(5489385..5491148)
AA seq 587 aa
MSHSDFNMEPEYVSFSDKDTKSILNESKSSLKDVKPSLEEKSYITPGLVDDVEPKGKNFV
VRFFDDFKPAKATGEDGTALKRSLKSRHMQMISIGGAIGTGLYVGSGSSLADGGPASVII
NYSLIGIMMFFIVYALGEMAVAYPVAGGFNTYATRFIDPAWGFAVSWNYFINYFVTFPLE
LTTCAITFRYWTDINSAAWISIFLVVIIIVNLFGVRAYGEVEFILSTVKVVATFGFIILA
IIINCGGVPTDHRGYIGGSIIKHKPFRHGFKGFCSVFTTAAFSFSGTEVIGLAAAEVDNP
QKALPHAVKQVFWRIAIFYVVSLILIGLLISPDDPNLMGNGSTSVSPFVLAIKEANIKGL
PSVFNAVIIISVVSVTNSSTYTAGRTLHGMANLKQAPSFFKYTDRLGRPLLAMIVVLLFG
FFAYINEADKNGNDVSDTVFNWLLALSGLSNFFTWGSICLCHIIFRLAFKKQGHSLKELG
FVSPMGIWGSCIGLFFNILCLMAQFYVSLFPIGGKPNANDFFQGYLAAPVTLAFFIGYKI
YDRSHIPSLDKLDITTGLKTYENLDEEEDEPTTASKRIFKKISSVFC
NT seq 1764 nt   +upstreamnt  +downstreamnt
atgtcccatagcgattttaatatggaaccagaatatgtctcttttagcgacaaggacact
aaatctatcctaaatgaaagcaaatcttctttgaaggatgtcaaaccttctttggaggaa
aagagttacattaccccgggattagttgacgatgtggagcctaagggtaaaaacttcgta
gtacgcttttttgatgactttaagcctgcaaaggcaacgggagaagatggcacggcgctt
aagcgtagtctgaaaagccggcatatgcaaatgatatctattggaggtgcaattggtaca
ggtctatatgtcggttcaggtagttcgcttgcagatggcggacccgcttcagtgatcatt
aattacagcttaattggaattatgatgttctttattgtttatgcgcttggtgaaatggct
gttgcttatccggtcgctggtggattcaatacctatgctacccgtttcattgatccagct
tggggatttgcggtaagttggaactacttcatcaactatttcgttacttttccacttgaa
ttaacaacttgcgctatcacatttcggtactggacggatattaatagcgcagcttggatc
tctatttttctggttgtcattattatagtcaatctttttggcgttcgcgcatatggagaa
gtggagtttattttaagtactgttaaagtggtcgctacctttggattcatcattttggcc
atcatcatcaattgcggtggtgttccaactgatcaccggggttacattggcggaagtatt
ataaaacataagccgtttcgacatgggttcaaaggattttgttctgtctttactactgcg
gctttctccttttctggtactgaagtcattggtttagcggcggctgaagttgacaatcct
cagaaagcgcttcctcatgccgttaagcaagttttttggcgtattgctatattttatgtt
gtctccttgatattgatcggtttgcttattagccccgatgatcctaatttgatgggaaat
ggctctaccagtgtgtcacctttcgtacttgctattaaagaagcaaacatcaaaggccta
ccttccgtttttaacgctgttattattatttccgtcgtttctgtgacaaattccagcaca
tatacagccggtcgtaccctccatggtatggcgaatttaaagcaggcaccctccttcttt
aaatataccgatcgtcttggtcgtcctttacttgccatgatcgttgttctgttatttgga
ttctttgcttatatcaacgaagctgataaaaatggtaacgatgttagtgatacggtattc
aattggttgcttgctctatctggtctgtcaaacttttttacctggggaagtatatgtctt
tgtcatatcatatttcgcttggcgtttaagaaacaaggacattccctaaaagaattggga
tttgtatctcctatgggtatttggggatcttgcattggattatttttcaatattttatgc
cttatggcacaattttatgtctccttatttccaatcggtggaaaaccaaatgcaaatgat
tttttccaggggtatttggcggcacccgttacactcgctttttttatcggttataaaata
tatgatagatcgcacatcccttctttggataaactagacattactactggtcttaaaaca
tatgagaatctcgatgaagaagaagatgagcccaccactgcttctaagaggattttcaag
aaaatcagttcggttttctgttaa

DBGET integrated database retrieval system