KEGG   Schizosaccharomyces pombe (fission yeast): SPAC8E11.01cHelp
Entry
SPAC8E11.01c      CDS       T00076                                 

Definition
(RefSeq) beta-fructofuranosidase (predicted)
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00052  Galactose metabolism
spo00500  Starch and sucrose metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SPAC8E11.01c
   00500 Starch and sucrose metabolism
    SPAC8E11.01c
Enzymes [BR:spo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     SPAC8E11.01c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 2542702
NCBI-ProteinID: NP_594168
PomBase: SPAC8E11.01c
UniProt: O42878
Position
I:3386047..3387573
Genome map
AA seq 508 aa AA seqDB search
MPVRPCIHFTPPEGFMNDPNGLVYSNGKWHLFFQWNPTGNQAGNQHWGHAVSKNLYKWKL
LPTALAPGDDHGLMFSGSAVIDKTNSSGFFESGFFSRKSVDPEERIVLIYTTHYDNRETQ
NIAYSLDGGITFIKYKKNPILDIKESQFRDPKVFWHEESRAWIMVVVLAQKYKVLFYHSL
NLRDWVKLSEFGSAGVLGYQYECPDFVRLPIEGTDEFRWVLIVSINPGSSINGGSMVQYF
IGDFDGQTFTPIDSASRILDCGHDCYATQTFGNAPDGRVISISWASNWNYTNDVPMRMKH
RGMFTIPRELTLCYTHLNQETRGLVLRQRPVNLHHLYYPDSLPAPLLLNRVCEFPTVWTS
ATVFYLAVSIPKSIVLESPMEFLCLTWSTTPDVETSKEYFELGYRFHDGAVYVERGVCSS
SWKYPLYPERCTSSVPPSSYEDNYILEIEAVVDHSIIEVYLQGGIMCLTNAYYFKGDEPL
QYYYLRVPTGASLAKSGMQPLLNNRPHS
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtgagaccatgcatacatttcacgcctccagaaggatttatgaatgatcccaat
ggtctggtttacagtaatggaaaatggcatttgttttttcaatggaatccaacaggaaac
caagccggtaatcaacattggggccatgcagtgagtaaaaacctgtataaatggaaatta
ctacctaccgcccttgcacctggagacgatcatggattaatgtttagcggaagcgcagtg
atcgataaaaccaactcatcaggcttttttgaaagtggatttttttcgagaaagtcggtt
gaccctgaagaaagaattgtgttgatttatacaacgcattatgataatcgtgaaactcaa
aacattgcctactcattggatggaggtatcacatttatcaaatacaaaaagaatcccatc
ctcgacatcaaggaatcgcagttccgcgacccaaaagtgttttggcatgaagaaagtaga
gcatggatcatggttgtagtgttagctcaaaaatacaaagttctgttttaccattcccta
aaccttcgcgattgggtaaaactttcggaatttggttctgcaggcgttttaggataccaa
tacgaatgccctgactttgttcgtctccctatcgagggtaccgacgagtttcgatgggta
ctgattgtttccattaatcctggttcttcgatcaatgggggtagcatggttcaatatttt
attggagattttgatggtcaaaccttcactccaattgatagcgcgtccagaattttggat
tgcggtcacgattgctatgccactcaaacgtttggtaatgcacccgatggaagagtcatt
tccatctcttgggcaagtaactggaactatacgaacgatgttcctatgcgtatgaaacat
cgaggtatgtttactattcctcgagaacttactctttgctacacccatctcaatcaagaa
acgcgtggtcttgtgctacgtcaacgtccagttaatcttcaccatctttactatccagat
tctctaccagctccacttttgttaaaccgtgtctgtgaatttcctactgtctggactagt
gccactgtattctacctcgccgtttccattccgaaaagtattgtattagaatcccctatg
gagtttttatgcttgacatggtctaccacgccagatgttgagacctctaaggagtatttt
gaacttggataccgattccacgacggtgccgtctacgtcgaaaggggtgtatgctcgtct
agttggaaatatcctttatatcctgaacggtgtacgtcttctgttcctccctcttcttac
gaagataattatatattggaaattgaagctgtagtagatcactccattattgaagtttat
ttgcaaggaggaataatgtgcttaacaaacgcctactattttaagggagatgaaccattg
cagtattactaccttcgtgtcccgactggagcttctttagctaaatcaggcatgcaacca
ttattaaacaacagaccgcattcctag

DBGET integrated database retrieval system