KEGG   Schizosaccharomyces pombe (fission yeast): SPAC8E11.02cHelp
Entry
SPAC8E11.02c      CDS       T00076                                 

Gene name
rad24
Definition
(RefSeq) 14-3-3 protein Rad24
  KO
K06630  14-3-3 protein epsilon
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04011  MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:spo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    SPAC8E11.02c (rad24)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPAC8E11.02c (rad24)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPAC8E11.02c (rad24)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    SPAC8E11.02c (rad24)
Exosome [BR:spo04147]
 Exosomal proteins
  Proteins found in most exosomes
   SPAC8E11.02c (rad24)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 14-3-3 DUF3802 TPR_12
Motif
Other DBs
NCBI-GeneID: 2542029
NCBI-ProteinID: NP_594167
PomBase: SPAC8E11.02c
UniProt: P42656
Position
I:join(3384268..3384337,3384745..3385487)
Genome map
AA seq 270 aa AA seqDB search
MSTTSREDAVYLAKLAEQAERYEGMVENMKSVASTDQELTVEERNLLSVAYKNVIGARRA
SWRIVSSIEQKEESKGNTAQVELIKEYRQKIEQELDTICQDILTVLEKHLIPNAASAESK
VFYYKMKGDYYRYLAEFAVGEKRQHSADQSLEGYKAASEIATAELAPTHPIRLGLALNFS
VFYYEILNSPDRACYLAKQAFDEAISELDSLSEESYKDSTLIMQLLRDNLTLWTSDAEYS
AAAAGGNTEGAQENAPSNAPEGEAEPKADA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtctactacttctcgtgaagatgctgtttatttagccaaacttgctgagcaagccgag
cgctatgaaggcatggttgaaaacatgaaaagcgttgcctccactgatcaagaattgacc
gtcgaagagcgtaacttgctctctgttgcttataagaatgtaattggagctcgccgggcg
tcttggcgtatcgtttcctccatcgagcaaaaggaggagagcaaaggcaatactgctcaa
gttgaattaattaaggaatatcgtcaaaagattgaacaagaacttgacactatttgccaa
gatatcttgaccgttcttgagaagcaccttatccctaatgctgcctctgccgaatccaag
gttttctactacaagatgaagggtgactactatcgttaccttgctgagtttgccgttggt
gagaagcgccaacactccgctgatcaatctcttgaaggttacaaggccgcttctgaaatt
gctaccgccgaacttgcacctactcatcctatccgcttaggtcttgctcttaatttctcc
gttttctactatgagatcttgaactcccccgaccgtgcttgctacttagccaagcaagcc
tttgatgaagctatctccgagttggacagcctttccgaggaatcctacaaagattctact
ttaatcatgcaattgttgcgtgacaaccttaccttatggacttctgatgctgaatacagt
gccgccgctgctggtggtaacaccgagggagctcaagaaaacgctccttccaatgctcca
gaaggcgaagctgagcccaaggcggacgcatag

DBGET integrated database retrieval system