KEGG   Schizosaccharomyces pombe (fission yeast): SPAC8F11.03
Entry
SPAC8F11.03       CDS       T00076                                 
Symbol
msh3
Name
(RefSeq) DNA mismatch repair protein
  KO
K08736  DNA mismatch repair protein MSH3
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    SPAC8F11.03 (msh3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPAC8F11.03 (msh3)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     SPAC8F11.03 (msh3)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I MutS_II MutS_IV AAA_14
Other DBs
NCBI-GeneID: 2543392
NCBI-ProteinID: NP_593952
PomBase: SPAC8F11.03
UniProt: P26359
Position
I:2855630..2859170
AA seq 1004 aa
MRGMSYNITHECDAINILSDNLHEGAISEDMVALSGPAIELLENNVGSSKNSYQEDEGSS
SIDENAPLISIKRKRRIRTVKSTSNKELVQRKASKPTKQKSVFTPLEQQYLELKKNYQET
ILAIEVGYKFRFFGKDAKIASEVLGISCYFEHNFLNASVPSYRIDYHLERLINFGLKVAV
VRQTETAALKSTSSSRNTLFDRRVARVLTKGTTLDDSFFRFEQTQHGTLQASQFILCVAD
NVDKSKAKSGRVQVGLIAIQLSSGTTVYDHFQDDFLRSELQTRLSHFQPCELIYSNKLSS
ESVALLNHYVSTEKTCGRVVRVQHAVQQDVKLALENLQDFFSSKCIMSGSKIIELHMEKV
KSLHSLSIICLDMAISYLMEFSLEDLFVASNFYQPFDSISSMVLSKQALEGLELFVNQTD
HTPVGSLFWVLDRTYTRFGQRMLQRWLQKPLVDKENIIERLDAVEELAFNSNSQVQAIRK
MLYRLPDLEKGLSRIYYQRCTPSEMFHVLKGFYKAASAFSKNSYSCFKSALLRRLIQQLP
SISSIIDHFLGMFDQKEAENNNKVDMFKDIDNFDLSEEPNDVDYELAQEIRELKMSILMV
RTEMDFHLQELRDYLEYPNLEFSIWGNVKFCIEVSKGCKKIPPDWIKLSSTRSLFRFHTP
KIQSLLIELSSHEENLTISSEKIYRSFLSRISEHYNELRNVTTVLGTLDCLISFARISSQ
SGYTRPEFSDKELLIHESRHPMIELLSDKSFVPNHIHLSSDGVRCLLITGPNMGGKSSFV
KQLALSAIMAQSGCFVPAKSALLPIFDSILIRMGSSDNLSVNMSTFMVEMLETKEVLSKA
TEKSMVIIDELGRGTSTIDGEAISYAVLHYLNQYIKSYLLFVTHFPSLGILERRFEGQLR
CFHMGYLKSKEDFETSVSQSISFLYKLVPGVASKSYGLNVARMAGIPFSILSRATEISEN
YEKKHRNARKNVFIRKVAKLLMILNAEEIDFKRLFYDLTAFEEI
NT seq 3015 nt   +upstreamnt  +downstreamnt
atgagaggaatgagttataacattactcatgaatgcgacgctattaatattctatcagat
aatttacatgaaggagcaatatcagaagatatggttgccctcagtggtccagccatagag
ttactagaaaataatgttggtagttcaaaaaatagctatcaagaagatgagggaagttct
tcgattgatgagaacgcgcctcttataagcataaaacgaaagaggagaattcgtacggtt
aaatctacttcaaataaagaattagtgcaaagaaaagcatcgaaacctactaaacagaaa
tctgttttcacaccacttgagcagcaatacttagaattgaagaaaaattatcaagaaact
attttggcaattgaagtaggatataagttccgattttttgggaaggatgcaaaaatagcc
tctgaggtgttaggaattagttgctattttgagcacaattttttaaatgctagtgttccc
tcgtatcgtattgactatcacttggaaagactcattaattttggtctcaaagttgctgtt
gttcgacaaactgaaacagccgctctcaagtcaactagctctagcagaaacactctgttt
gacagacgagttgctcgcgtgcttaccaaggggactactctagatgatagcttttttcgc
tttgagcaaacacagcatggtacactacaagcttcccaatttatcctatgtgttgcagat
aatgttgataagagcaaagcaaaatcaggaagagttcaggttggactaattgccatacaa
ttatcatctggaactactgtttatgatcattttcaagatgattttttgagaagcgaatta
caaacaagactttctcattttcaaccttgtgaattgatatattcgaacaagttatcttcc
gaatcggttgccctactgaatcattacgtatcaactgaaaaaacttgcggtagagtagtg
cgtgtgcaacatgctgttcagcaggacgtgaaactagcattggagaatttgcaggacttc
ttttcttctaaatgcatcatgtccggtagcaaaattatagaattacacatggaaaaggtg
aagtctttacattctctttcaatcatttgtttggacatggccatttcttatttgatggaa
ttctcattggaagatctattcgttgcttcaaacttttatcaaccttttgatagcatttct
tctatggttttaagtaaacaggctttggaaggtcttgagcttttcgttaatcaaacagat
catacacctgttggtagcctattttgggtgttagatcgcacatacacaagatttggacaa
aggatgcttcagagatggcttcaaaagcctttggttgataaagaaaatataatcgagcgt
ctggacgcggttgaggaattagcctttaattctaatagtcaagttcaagcaattcgtaaa
atgctgtatagattgcccgatctcgaaaagggtctgtccagaatctactatcaaaggtgc
actccgtctgaaatgttccatgttttgaagggtttttataaagccgcatctgctttctcg
aaaaattcatactcttgttttaagtcagcattgcttagaagactaattcaacagcttcct
agcatatcgtctatcattgatcatttcttgggaatgtttgatcaaaaagaagctgaaaat
aacaacaaggttgacatgttcaaggatattgacaattttgatttatcagaagagccaaac
gatgtagattatgagttggcacaggaaattcgagagctgaaaatgagtattttgatggtc
agaactgaaatggattttcaccttcaagaattgagagactatttagaatatcctaatttg
gagttttctatttggggaaatgtcaaattctgcattgaagtttctaaaggatgtaaaaaa
attccaccagattggatcaagttaagttctactcgatctcttttccggtttcatacacca
aaaattcaatctctcttgattgaattgtcttctcatgaagaaaacctaacaatttcaagt
gaaaaaatttatcgctcatttctttctagaatatctgaacattacaatgaattgcgaaat
gttacaacagtattggggacattggattgcttaatttcttttgcccggatttcttctcaa
tcgggttatacaaggccagaattttcagataaggagctgttaatacatgaatctcgacat
ccaatgattgaattgctaagtgataaatcttttgtacctaaccatattcatctaagttct
gatggtgtcaggtgtttgttaattacgggcccaaatatgggcggaaaaagttcttttgtt
aaacaattagcacttagcgccattatggctcaaagtggttgctttgttccagcaaaaagt
gctctgcttcctatttttgattcgattcttatcagaatgggatcatctgacaacctttct
gtgaacatgtctacttttatggtagagatgctcgaaaccaaggaggttttaagcaaggct
acagaaaaatcaatggtcattattgacgaattaggtcggggtactagtactattgatgga
gaagctatttcttatgcagtcttgcactatttaaatcaatatataaaatcttatttattg
tttgtgacacattttcctagtttaggaatactagaaagaaggtttgaagggcaacttcgt
tgctttcacatgggttacttaaaatcaaaggaagactttgagactagcgtttcacagtct
atatcatttctttacaaattggttcctggggttgcttcaaaaagttatgggttaaatgtt
gctagaatggcaggaattccgttttcaattttaagtcgtgcaaccgaaattagtgaaaat
tacgaaaagaagcatagaaatgcaaggaaaaatgttttcatacgaaaggttgcaaaacta
ttaatgattcttaatgccgaagagattgattttaaaaggcttttctatgatcttaccgct
ttcgaagaaatctga

DBGET integrated database retrieval system