KEGG   Schizosaccharomyces pombe (fission yeast): SPAC8F11.09c
Entry
SPAC8F11.09c      CDS       T00076                                 

Gene name
nnt1
Definition
(RefSeq) putative nicotinamide N-methyltransferase Nnt1
  KO
K17878  EEF1A N-terminal glycine/lysine methyltransferase [EC:2.1.1.-]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:spo03012]
    SPAC8F11.09c (nnt1)
Enzymes [BR:spo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     SPAC8F11.09c (nnt1)
Translation factors [BR:spo03012]
 Eukaryotic type
  Elongation factors
   Elongation associated factors
    SPAC8F11.09c (nnt1)
SSDB
Motif
Pfam: Methyltransf_16 GidB PrmA NNMT_PNMT_TEMT
Other DBs
NCBI-GeneID: 2543599
NCBI-ProteinID: NP_593958
PomBase: SPAC8F11.09c
UniProt: Q9UT28
Position
I:complement(join(2868517..2869171,2869265..2869377))
AA seq 255 aa
MADNDFEGFGIFEEPEGFRPSTPPPKEVLHTRVIVPNGPEEIKLRLVGSHSLWAHYLWNS
GIELANYIDKNPDTVRAKKVLELGAGAGLPSIVSAFDGAKFVVSTDYPDPALIDNLEHNV
KQYAEIASKISAVGYLWGSNIKEVMSNAGFKDNEVFDILLLSDLVFNHTEHSKLIKSCKM
AIEGNPNAVVYVFFTHHRPHLAKKDMIFFDIAQSEGFQIEKILEEKRTPMFEEDPGAPEI
RATVHGYKMTIPIPV
NT seq 768 nt   +upstreamnt  +downstreamnt
atggccgataatgatttcgagggatttggaatttttgaagaacctgaagggtttcgacct
tctactcctcctcctaaagaagttttacacacacgagttatagtgccgaatggaccagaa
gaaatcaagttgcgattggtagggagtcattcattatgggcacattatctctggaacagc
ggcattgaattagccaactatattgacaaaaaccctgacactgtacgtgcaaaaaaggta
cttgaacttggagctggagctggtcttccttccattgtttctgcttttgacggagcaaaa
tttgtagtttcgactgattaccctgatcctgctttaatcgataaccttgagcataatgtt
aagcaatatgctgaaatagccagtaaaatttctgcagtgggatatctctggggttctaac
ataaaagaagtcatgtcgaatgctggttttaaagacaatgaggtgtttgatattttactg
ctttctgatttagttttcaaccatactgagcattcaaagctgataaaatcttgcaaaatg
gctattgaaggtaatccaaacgctgtagtctacgttttctttacccatcaccgtccacat
ctggctaaaaaagatatgatcttcttcgacatcgctcaaagtgagggttttcagattgaa
aagattttagaagaaaaaagaacccctatgtttgaagaggaccctggcgctcctgaaata
cgtgctacggttcacgggtataaaatgactattcctatcccggtttag

DBGET integrated database retrieval system