KEGG   Schizosaccharomyces pombe (fission yeast): SPAC9.05
Entry
SPAC9.05          CDS       T00076                                 

Gene name
fml1
Definition
(RefSeq) ATP-dependent 3' to 5' DNA helicase
  KO
K14635  ATP-dependent DNA helicase MPH1 [EC:3.6.4.12]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPAC9.05 (fml1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SPAC9.05 (fml1)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     SPAC9.05 (fml1)
SSDB
Motif
Pfam: ResIII Helicase_C DEAD ERCC3_RAD25_C AAA_22
Other DBs
NCBI-GeneID: 2543668
NCBI-ProteinID: NP_593348
PomBase: SPAC9.05
UniProt: Q9UT23
Position
I:join(1471060..1472508,1472554..1473383,1473440..1473665)
AA seq 834 aa
MSDDSFSSDEDWDELDTQVVDKIENEYHNNTIGLNGYSVDEYFDANDSNRYRLQHELDES
AAQQWVYPINVSFRDYQFNIVQKALFENVLVALPTGLGKTFIAAVVMMNYLRWFPKSYIV
FMAPTKPLVTQQMEACYKITGIPKSQTAELSGHVPVTTRNQYYQSRNVFFVTPQTILNDI
KHGICDRTRISCLVIDEAHRSTGNYAYVEVVHLLSLSNKNFRILALSATPGNKLEAIQNV
IDSLHISRIEIRTENSIDISQYVQKKEVDFFPVDLSAEITDIRDRFSSILEPMLQKLNKG
NYYRIQNAKDITSFTVVQAKQAFLAMSGQNFPANQKWDILNTFDALATFAYPLNLLLNHG
IRPFYQKLREVEEECFVGRSGYKKRIINHENYRPLMDDIEILLRDQSFVGHPKLEHLERI
VTEYFEKEQTKDTRIMIFVEIRSSAEEILRFLGKFYPNVRPAIFIGQSAVRKAAGMSQKL
QNETVKQFQKGEVNTLIATSIGEEGLDIGEVDMIICYDASASPIRMLQRMGRTGRKRKGY
IYMLLTRGKEEAKWERAKDAYRTLQDNIVSGRGLSLSEKSYRILPEKFRPVCDKRVIEIP
KENEEVVVAPKKVQLRTKIKKKFFMPENALNGFITASALGKPKRALAKSEESPFEICPVT
YSIEQEKKLEKYKRVCLRGLDIHRNRRLSQLSVTGRIPHSLATKSIHSFLKHLNTIDSQK
AQEWRREINNQFQVSNINSTDRDTKQPKMHDFRQPLHPNPMTTLKRKGQHNSFSYDKSTL
FYDNNNNLEEDLPDVNISISSRNEEASKTKPFDDRQQRLQQLVEKRKRMKGMLI
NT seq 2505 nt   +upstreamnt  +downstreamnt
atgtccgatgattcttttagtagtgatgaagactgggacgaattggacacccaagtagtt
gataaaattgagaatgaatatcataataacacgataggtttaaatggatactcagttgat
gaatattttgatgccaacgattccaatagatatcgtctacaacacgagttagatgaaagt
gcagcacagcaatgggtataccctataaacgtctcctttcgagattatcagtttaatatt
gtccaaaaagctttatttgaaaatgtacttgtagctttgccaacaggtttaggtaaaaca
tttattgcagccgttgtgatgatgaattatcttcgttggtttccaaaaagttacattgtt
ttcatggctcctactaaaccattggttacacaacaaatggaagcttgctataaaatcact
ggaattccaaagagtcaaactgctgaattaagtggacacgttcctgttacaactcgaaat
cagtattatcaaagtcgaaatgttttcttcgtaactcctcaaaccattttaaacgacatc
aagcatggaatttgcgatcggactcgtatatcttgtttagtaattgatgaagcacatcgt
agtactggaaattacgcttatgtggaagttgttcatctactttctcttagcaacaaaaat
ttccgtatactggctcttagtgctacccccggaaataagttagaagcaattcagaatgta
attgattctcttcatatatccaggattgagattagaactgaaaacagcattgatatatcg
caatacgttcagaagaaagaggtggatttttttcctgtagatttgtctgcagagattaca
gatataagagatcgattttcttctatattggaacctatgcttcaaaaattgaacaagggt
aattattatcgaattcagaatgctaaagacataacttctttcactgtggttcaagctaaa
caagcttttcttgcaatgtctggtcaaaactttcctgctaatcaaaaatgggatatttta
aatacttttgatgcattagcgacttttgcctatcctttaaatttgttactcaaccatggt
atccgaccgttttatcaaaaattgcgagaggtagaagaagaatgctttgtaggaagatca
ggttataagaaacgcataataaatcacgaaaattatcgtcctttaatggacgatatagaa
attttgttgcgagatcagtcttttgtcggacatcccaaactagagcatttggaacgtatt
gttacagaatattttgaaaaagaacaaaccaaggataccagaattatgatttttgttgaa
atccgctctagcgccgaagagattttacgatttttgggtaaattttatccaaatgtgaga
ccagctatttttattggacaatctgctgtgagaaaggctgctggaatgtctcaaaaatta
cagaatgaaactgtgaaacaatttcaaaaaggtgaagtcaatactttaatagctacctct
attggagaagagggtttggacataggtgaagtagacatgatcatatgttacgatgcatct
gcttctcctataaggatgttacaaagaatgggcagaactgggagaaaaaggaaaggttat
atttatatgcttttgacgcgaggcaaagaagaagcaaaatgggagagagccaaagacgct
tatcgaactttgcaagataatattgtcagtggtcgcggtctcagcctatcggaaaaaagt
tatagaattttaccagaaaagtttcgcccggtttgtgataaacgagtcatagaaattccc
aaagaaaatgaagaagttgtagtagctccaaagaaagtgcaattgagaacgaaaataaaa
aagaaatttttcatgccagaaaatgccttgaatggatttattactgcgtccgctttaggt
aaaccgaaacgtgctttagccaagtctgaagaatcaccgttcgagatatgtcccgttaca
tatagcattgaacaagaaaagaaactggaaaaatataagcgtgtttgcttaagaggtttg
gatattcatagaaataggaggttatctcaattgagtgttacaggacggataccgcattct
ctagctacgaaaagtatacattcatttttaaagcatttaaatactatagattcgcaaaag
gctcaggagtggagaagagaaataaacaaccaattccaagtatcaaatatcaactcgacg
gatcgtgacacaaaacagccaaagatgcatgactttagacaacctttacacccaaatccg
atgacaactttgaaaaggaaaggacaacataattcattttcttacgacaagtctacactg
ttttatgacaacaacaataatttagaggaagacctcccggatgtaaatatttctatatct
tcaaggaatgaagaagcatccaagacaaaaccatttgacgaccgacaacaacgccttcag
caactcgtagagaaaaggaaacgtatgaaaggaatgctgatttag

DBGET integrated database retrieval system