KEGG   Schizosaccharomyces pombe (fission yeast): SPAC926.03
Entry
SPAC926.03        CDS       T00076                                 

Symbol
rlc1
Name
(RefSeq) myosin II regulatory light chain Rlc1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: EF-hand_6 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_9
Other DBs
NCBI-GeneID: 2543545
NCBI-ProteinID: NP_594364
PomBase: SPAC926.03
UniProt: Q9UUG5
Position
I:3887570..3888124
AA seq 184 aa
MFSSKENSLGAKRAPFSSNTTSSQRVAAQAAKRASSGAFAQLTSSQIQELKEAFALLDKD
GDGNIGREDVKTMLTSLNQDASEDSINHMFESINPPINLAAFLTAMGSMLCRISPRNDLL
EAFSTFDDTQSGKIPISTMRDALSSMGDRMDPQEVESILRSYTSHGVFYYEKFVDAIAGS
KDSN
NT seq 555 nt   +upstreamnt  +downstreamnt
atgttctcttcgaaggaaaattccttaggtgctaaacgtgccccattttcatcaaataca
acatcttctcaaagagttgctgcccaagccgctaaacgagcatcttctggtgcatttgcg
caacttacttcttcccaaattcaagaacttaaagaggcttttgccctattagacaaagat
ggtgacggtaatattggaagagaggatgtcaaaaccatgcttacttctttgaatcaggat
gcctccgaagattcaatcaatcacatgtttgagtcaataaatccgcctattaatttagcc
gcttttctcactgcgatgggtagtatgctgtgtcgaatctcccccagaaatgatctacta
gaagcgttctctacattcgatgatactcaatccggcaaaattccaatttccactatgaga
gatgctttgtcaagtatgggtgatagaatggatcctcaagaagtcgagtctattttacgc
tcgtacaccagtcatggtgtattctattacgagaaattcgttgatgctattgctgggtca
aaagatagcaattga

DBGET integrated database retrieval system