KEGG   Schizosaccharomyces pombe (fission yeast): SPAC926.04c
Entry
SPAC926.04c       CDS       T00076                                 

Gene name
hsp90
Definition
(RefSeq) Hsp90 chaperone
  KO
K04079  molecular chaperone HtpG
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SPAC926.04c (hsp90)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:spo01009]
    SPAC926.04c (hsp90)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:spo03110]
    SPAC926.04c (hsp90)
   04131 Membrane trafficking [BR:spo04131]
    SPAC926.04c (hsp90)
   03051 Proteasome [BR:spo03051]
    SPAC926.04c (hsp90)
   03029 Mitochondrial biogenesis [BR:spo03029]
    SPAC926.04c (hsp90)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPAC926.04c (hsp90)
Protein phosphatases and associated proteins [BR:spo01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     SPAC926.04c (hsp90)
Chaperones and folding catalysts [BR:spo03110]
 Heat shock proteins
  HSP90
   SPAC926.04c (hsp90)
Membrane trafficking [BR:spo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    SPAC926.04c (hsp90)
Proteasome [BR:spo03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    SPAC926.04c (hsp90)
Mitochondrial biogenesis [BR:spo03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    SPAC926.04c (hsp90)
Exosome [BR:spo04147]
 Exosomal proteins
  Proteins found in most exosomes
   SPAC926.04c (hsp90)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 Ubiq-assoc Cofac_haem_bdg
Other DBs
NCBI-GeneID: 2543539
NCBI-ProteinID: NP_594365
PomBase: SPAC926.04c
UniProt: P41887
Position
I:complement(3888774..3890888)
AA seq 704 aa
MSNTETFKFEAEISQLMSLIINTVYSNKEIFLRELISNASDALDKIRYQSLSDPHALDAE
KDLFIRITPDKENKILSIRDTGIGMTKNDLINNLGVIAKSGTKQFMEAAASGADISMIGQ
FGVGFYSAYLVADKVQVVSKHNDDEQYIWESSAGGSFTVTLDTDGPRLLRGTEIRLFMKE
DQLQYLEEKTIKDTVKKHSEFISYPIQLVVTREVEKEVPEEEETEEVKNEEDDKAPKIEE
VDDESEKKEKKTKKVKETTTETEELNKTKPIWTRNPSEVTKEEYASFYKSLTNDWEDHLA
VKHFSVEGQLEFRAILFVPRRAPMDLFEAKRKKNNIKLYVRRVFITDDCEELIPEWLGFI
KGVVDSEDLPLNLSREMLQQNKIMKVIRKNLVRRCLDMFNEIAEDKENFKTFYDAFSKNL
KLGIHEDAANRPALAKLLRYNSLNSPDDLISLEDYITKMPEHQKNIYFITGESKQAVENS
PFLEIFRAKKFDVLFMVDPIDEYAVTQLKEFEGKKLVNITKDGLELEETDEEKAAREKLE
KEYEEFAKQLKTILGDKVEKVVVSNKIVGSPCLLTTGQYGWSANMERIMKAQALRDTSMS
AYMSSRKTFEINPKSPIIAELKKKVEENGAEDRSVKDLATILYETALLSSGFTLDDPSAY
AQRINRLISLGLSIDEEEEAPIEEISTESVAAENNAESKMEEVD
NT seq 2115 nt   +upstreamnt  +downstreamnt
atgtcgaacacagaaactttcaagtttgaggctgaaatcagccagttgatgtctttaatc
atcaacactgtttattctaacaaggaaattttccttcgtgagcttatttccaacgcttcc
gatgccttggacaaaattcgttatcaaagcctttccgatcctcatgccttagacgctgag
aaggatcttttcattcgcattactcctgacaaggagaacaaaatccttagcattcgcgat
accggtattggtatgaccaagaatgaccttatcaacaaccttggtgttatcgccaagtct
ggtactaagcagtttatggaagctgctgcttctggtgctgatatctccatgattggtcaa
ttcggtgttggtttctactctgcatacttggttgccgacaaggtccaagtcgtaagtaag
cataatgacgatgagcaatacatctgggaatcctctgctggtggtagcttcaccgtcact
ttggacaccgatggacctcgcttgttacgtggtaccgagattcgtctcttcatgaaagaa
gaccaacttcaatacctcgaggaaaagactatcaaagataccgtcaagaaacatagtgag
ttcatctcttaccccattcaattagttgttacccgtgaggttgagaaggaggtccctgaa
gaagaagagaccgaagaagttaagaatgaagaagacgataaggctcctaagattgaggag
gttgatgatgaatctgagaagaaggagaagaagaccaagaaggtcaaggagaccaccact
gagactgaggagttgaacaagaccaagcccatttggactcgcaaccccagtgaagttacc
aaggaagagtatgcctctttctacaagtctttgactaacgactgggaagaccatttggcc
gtcaagcacttcagcgttgaaggtcaattggaattccgtgccattcttttcgtcccccgc
cgcgctcctatggacctttttgaggccaagcgtaagaagaacaacatcaagctctatgtt
cgccgtgttttcattaccgacgactgtgaagagttgattcctgaatggttgggtttcatt
aagggtgttgttgattctgaggacttgcccttgaacttgtctcgtgagatgcttcaacaa
aacaagatcatgaaggttattcgtaagaaccttgtccgtcgttgtcttgatatgttcaac
gagattgccgaggacaaggagaacttcaagactttctacgatgctttcagcaagaatttg
aagcttggtatccatgaggatgctgctaaccgccctgctttagccaagcttttgcgttac
aactcccttaactcccctgatgatcttatcagtcttgaggactacatcactaagatgccc
gaacatcaaaagaacatttatttcatcactggtgaatctaagcaagccgttgagaactct
cccttcttggaaatcttccgtgccaagaagtttgatgttctcttcatggttgaccccatt
gatgagtacgctgtcactcaactcaaggaattcgagggcaagaaattggttaacattact
aaggatggtcttgagttggaagagactgacgaggagaaggctgctcgcgagaagctcgaa
aaagagtatgaggagtttgctaagcaacttaagaccattttgggtgacaaggttgaaaag
gttgttgtttctaacaagattgttggttctccttgcttgttaactaccggtcaatatggt
tggtctgctaacatggaacgtatcatgaaggctcaagcccttcgtgatacttctatgagt
gcctatatgtctagccgcaagacttttgagattaaccccaagtctcccatcattgctgag
ctcaagaagaaggttgaggagaatggtgccgaagaccgctctgtgaaggatcttgctact
attttgtatgagaccgccttgttgtcctctggtttcactcttgatgaccctagtgcttat
gctcaacgtatcaaccgtcttatttctcttggtcttagcattgacgaagaggaggaggct
cctattgaggaaatttctaccgaatccgtcgctgctgaaaacaatgctgagagcaagatg
gaggaagtcgattaa

DBGET integrated database retrieval system