KEGG   Schizosaccharomyces pombe (fission yeast): SPAC926.09c
Entry
SPAC926.09c       CDS       T00076                                 

Gene name
fas1
Definition
(RefSeq) fatty acid synthase beta subunit Fas1
  KO
K00668  fatty acid synthase subunit beta, fungi type [EC:2.3.1.86]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00061  Fatty acid biosynthesis
spo01100  Metabolic pathways
spo01212  Fatty acid metabolism
Module
spo_M00082  Fatty acid biosynthesis, initiation
spo_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SPAC926.09c (fas1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:spo01004]
    SPAC926.09c (fas1)
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.86  fatty-acyl-CoA synthase system
     SPAC926.09c (fas1)
Lipid biosynthesis proteins [BR:spo01004]
 Fatty acid synthase
  Yeast type
   SPAC926.09c (fas1)
SSDB
Motif
Pfam: DUF1729 Acyl_transf_1 FAS_meander FAS_N SAT MaoC_dehydratas MaoC_dehydrat_N
Other DBs
NCBI-GeneID: 2543497
NCBI-ProteinID: NP_594370
PomBase: SPAC926.09c
UniProt: Q9UUG0
Position
I:complement(3900367..3906588)
AA seq 2073 aa
MVEAEQVHQSLRSLVLSYAHFSPSILIPASQYLLAAQLRDEFLSLHPAPSAESVEKEGAE
LEFEHELHLLAGFLGLIAAKEEETPGQYTQLLRIITLEFERTFLAGNEVHAVVHSLGLNI
PAQKDVVRFYYHSCALIGQTTKFHGSALLDESSVKLAAIFGGQGYEDYFDELIELYEVYA
PFAAELIQVLSKHLFTLSQNEQASKVYSKGLNVLDWLAGERPERDYLVSAPVSLPLVGLT
QLVHFSVTAQILGLNPGELASRFSAASGHSQGIVVAAAVSASTDSASFMENAKVALTTLF
WIGVRSQQTFPTTTLPPSVVADSLASSEGNPTPMLAVRDLPIETLNKHIETTNTHLPEDR
KVSLSLVNGPRSFVVSGPARSLYGLNLSLRKEKADGQNQSRIPHSKRKLRFINRFLSISV
PFHSPYLAPVRSLLEKDLQGLQFSALKVPVYSTDDAGDLRFEQPSKLLLALAVMITEKVV
HWEEACGFPDVTHIIDFGPGGISGVGSLTRANKDGQGVRVIVADSFESLDMGAKFEIFDR
DAKSIEFAPNWVKLYSPKLVKNKLGRVYVDTRLSRMLGLPPLWVAGMTPTSVPWQFCSAI
AKAGFTYELAGGGYFDPKMMREAIHKLSLNIPPGAGICVNVIYINPRTYAWQIPLIRDMV
AEGYPIRGVTIAAGIPSLEVANELISTLGVQYLCLKPGSVEAVNAVISIAKANPTFPIVL
QWTGGRAGGHHSFEDFHSPILLTYSAIRRCDNIVLIAGSGFGGADDTEPYLTGEWSAAFK
LPPMPFDGILFGSRLMVAKEAHTSLAAKEAIVAAKGVDDSEWEKTYDGPTGGIVTVLSEL
GEPIHKLATRGIMFWKELDDTIFSLPRPKRLPALLAKKQYIIKRLNDDFQKVYFPAHIVE
QVSPEKFKFEAVDSVEDMTYAELLYRAIDLMYVTKEKRWIDVTLRTFTGKLMRRIEERFT
QDVGKTTLIENFEDLNDPYPVAARFLDAYPEASTQDLNTQDAQFFYSLCSNPFQKPVPFI
PAIDDTFEFYFKKDSLWQSEDLAAVVGEDVGRVAILQGPMAAKHSTKVNEPAKELLDGIN
ETHIQHFIKKFYAGDEKKIPIVEYFGGVPPVNVSHKSLESVSVTEEAGSKVYKLPEIGSN
SALPSKKLWFELLAGPEYTWFRAIFTTQRVAKGWKLEHNPVRRIFAPRYGQRAVVKGKDN
DTVVELYETQSGNYVLAARLSYDGETIVVSMFENRNALKKEVHLDFLFKYEPSAGYSPVS
EILDGRNDRIKHFYWALWFGEEPYPENASITDTFTGPEVTVTGNMIEDFCRTVGNHNEAY
TKRAIRKRMAPMDFAIVVGWQAITKAIFPKAIDGDLLRLVHLSNSFRMVGSHSLMEGDKV
TTSASIIAILNNDSGKTVTVKGTVYRDGKEVIEVISRFLYRGTFTDFENTFEHTQETPMQ
LTLATPKDVAVLQSKSWFQLLDPSQDLSGSILTFRLNSYVRFKDQKVKSSVETKGIVLSE
LPSKAIIQVASVDFQSVDCHGNPVIEFLKRNGKPIEQPVEFENGGYSVIQVMDEGYSPVF
VTPPTNSPYAEVSGDYNPIHVSPTFAAFVELPGTHGITHGMYTSAAARRFVETYAAQNVP
ERVKHYEVTFVNMVLPNTELITKLSHTGMINGRKIIKVEVLNQETSEPVLVGTAEVEQPV
SAYVFTGQGSQEQGMGMDLYASSPVARKIWDSADKHFLTNYGFSIIDIVKHNPHSITIHF
GGSKGKKIRDNYMAMAYEKLMEDGTSKVVPVFETITKDSTSFSFTHPSGLLSATQFTQPA
LTLMEKSAFEDMRSKGLVQNDCAFAGHSLGEYSALSAMGDVLSIEALVDLVFLRGLTMQN
AVHRDELGRSDYGMVAANPSRVSASFTDAALRFIVDHIGQQTNLLLEIVNYNVENQQYVV
SGNLLSLSTLGHVLNFLKVQKIDFEKLKETLTIEQLKEQLTDIVEACHAKTLEQQKKTGR
IELERGYATIPLKIDVPFHSSFLRGGVRMFREYLVKKIFPHQINVAKLRGKYIPNLTAKP
FEISKEYFQNVYDLTGSQRIKKILQNWDEYESS
NT seq 6222 nt   +upstreamnt  +downstreamnt
atggttgaggctgaacaagttcatcagtcgctgaggtcgttggttctttcttatgctcat
ttttcgccttccattctaattcctgcttcacaatacttgttggctgctcagcttcgcgat
gaattcctgtcccttcatcccgccccttcagccgagtcggtggagaaggaaggcgctgaa
cttgagtttgaacatgaactccacttactagctggtttcctcggtttaattgccgccaaa
gaggaagagactcctgggcaatatacccagctcttaagaattattactcttgaattcgaa
cgcaccttcttagccggtaatgaggttcatgccgtcgttcatagtttgggattgaacatt
cctgcgcaaaaagacgtcgttcgtttctactaccactcttgtgccttgattggtcagacc
acaaaattccatggatccgctttgttagacgagtcctcggtaaaattggcggccattttt
ggtggacaaggctatgaagattattttgacgaattgattgaactttatgaagtgtatgct
ccttttgcagctgaactgatccaggtgctctctaaacatctttttaccctttctcaaaat
gaacaggcatcaaaagtttattccaaaggacttaatgtacttgactggctcgctggcgag
cgaccggaacgtgactatttggtcagtgctcctgtctcccttcccctagttggtctcaca
cagctcgtgcacttctccgtaaccgcccaaatcttgggtttgaaccctggagagctggct
tctcgcttcagcgcagcttctggtcattcacagggcattgttgttgctgctgctgtttcc
gcttctactgattcagcttcttttatggaaaatgccaaagttgctttgactactttgttt
tggattggtgttcgctctcaacagactttcccaacaactacgcttcccccttcagtcgtt
gctgattcgctagcttcatctgaaggaaaccccactcccatgttagctgttcgtgattta
cccattgagactctgaacaagcatattgagaccaccaatactcacctacctgaagacagg
aaggtttctcttagtttggttaatggtcctcgcagttttgttgtcagtggacctgctcgc
tctttgtacggtttgaacctttccttgcgcaaagagaaagctgatggacaaaatcaatct
cgtatccctcattcaaagcgtaagcttcgctttatcaaccgattccttagcatttctgtt
cctttccatagcccctacttggctcctgttcgttctttattagaaaaggatttgcaaggt
ctccaattctccgctttgaaggttccagtctattctactgacgatgctggtgatttaaga
tttgaacaaccttccaagcttttattagctcttgcggtaatgattactgaaaaggttgtt
cattgggaagaagcttgtggtttccccgatgtcactcatatcattgacttcggacctggt
ggcatttcaggcgttggttcgttaacacgtgccaacaaggatggacagggcgtacgtgtg
attgttgctgattcctttgaaagcttggatatgggtgctaaatttgaaattttcgatcgt
gatgctaagtcaatcgagtttgctcctaactgggtcaagttgtatagtcccaagcttgtc
aagaataagttgggtcgtgtatacgttgatactagattgtctcgtatgctaggtctccct
cccttgtgggttgcaggcatgactcctactagcgttccttggcaattctgttctgccatt
gcgaaagctggctttacctacgagctagccggtggtggttactttgatccaaaaatgatg
cgcgaagccatccacaaactttctctcaatattccacccggtgctggtatttgtgttaac
gttatctacattaatccccgtacttatgcctggcagattcctttgattcgtgatatggtt
gctgagggttatcccattcgtggcgttactattgccgctggtattccttcattggaagtt
gctaatgagttgatttctacattaggtgttcaatatctttgcctcaagcctggatcagtt
gaagctgtcaacgctgtcattagcattgccaaggctaaccccactttccccattgttttg
caatggactggtggtcgtgcaggtggccatcactcgtttgaagactttcattctcccatt
ttgttgacatattctgcaatcagacgctgcgataacattgtcctcatcgccggtagtggt
ttcggtggagctgatgatactgagccttatttgactggtgagtggagtgctgcatttaaa
cttcctcctatgccttttgacggtatattgttcggctcacgtttgatggtagctaaggaa
gcacatacgtctttggctgcgaaggaggctattgtagctgctaaaggtgttgatgactcg
gagtgggagaagacttatgacggccctactggtggaattgtcacagtattatccgaactt
ggtgagcctatccacaagcttgcaacacgtggtatcatgttttggaaagagctcgatgac
actatattttcgcttcctcgtcctaaacgtcttccagccttgcttgctaagaaacagtac
attattaaacgacttaatgacgatttccaaaaagtgtatttccctgcacatatcgtagaa
caagtatctcctgaaaaattcaagtttgaggctgttgatagcgttgaggatatgacttat
gctgaactcttgtatcgtgcaattgatttgatgtacgttacgaaagaaaagagatggatt
gacgttactttacgtacttttactggtaaattgatgcgccgtattgaagaaagatttacc
caggatgttggaaagacaactcttattgaaaattttgaagaccttaatgatccatatcct
gtggctgctcgtttcctcgatgcttaccctgaagccagtactcaagatctcaacactcaa
gatgctcaatttttttactctctttgctccaatcctttccagaaaccagttccattcatt
cccgcaatcgatgatacttttgaattttacttcaagaaagattccctttggcagagcgaa
gatttggctgccgttgttggtgaagatgttggccgtgttgccatccttcaaggacccatg
gctgccaagcactcgacaaaggttaatgaacccgctaaagaacttcttgatggtattaat
gaaacccatattcaacattttattaaaaagttttatgctggcgatgaaaagaaaattcct
attgttgaatattttggtggtgttccacctgtcaatgtttctcataaaagtttggaatct
gtttctgttactgaagaggctggttctaaagtttacaaattaccagaaattggctctaac
agcgctttaccttctaagaagttatggtttgagttattggctggtcctgaatatacatgg
ttcagagctatctttaccacccaacgtgtagctaaaggatggaagctggaacataatccg
gtacgccgaatttttgctccacgttatgggcagcgtgctgttgttaagggcaaagataat
gatactgttgttgaattatatgagactcaaagtggaaactatgtacttgctgctcgttta
tcttatgatggtgaaactatcgttgtctctatgtttgaaaaccgtaatgctttgaagaag
gaggttcatttggacttcttgttcaagtacgagccctctgctggttattcacctgtgtca
gagatccttgatggcagaaatgatcgtatcaagcatttctactgggctttatggttcgga
gaggagccttatcctgagaatgcttcaattaccgatactttcactggccctgaagtgacc
gtcactggaaacatgattgaagatttttgccgtacagttggaaatcataatgaggcctac
actaagagagcaattagaaagcgtatggcccctatggattttgcaattgttgttggatgg
caagcaattaccaaggctattttcccgaaggctattgacggcgatttgcttagattggtt
catctgtctaactctttccgtatggttggtagccattcattaatggagggagacaaggta
accacgtctgcttctatcattgctattttgaacaacgattccggtaaaaccgtcactgtc
aagggtactgtttaccgtgatggaaaggaagttattgaagttattagtcggttcttgtat
cgtggtacttttactgactttgaaaatacttttgaacatacccaagaaaccccaatgcaa
ctcacccttgctactcccaaagacgtcgctgtcttacagtctaagagttggttccagttg
cttgatcctagtcaggatctttctggatcaatccttaccttcagactcaactcttatgtt
cgtttcaaggatcaaaaagtaaagagttccgttgaaactaaaggtatagtcctttccgaa
ttgccctcaaaagctatcatccaagtcgcttctgtcgattttcaatccgtcgattgccat
ggcaatcctgtcatcgaattcttgaagcgtaacggtaagcctattgagcagcccgtcgag
tttgaaaatggtggttacagtgtaattcaagtcatggatgagggatactcacctgtcttt
gttactcctcctactaactcgccttatgcagaggtgtctggtgattacaatcctattcat
gtttctcctacattcgctgcatttgttgaacttcctggtactcatggtattacccatggt
atgtatacttctgctgctgctcgtagatttgttgaaacttatgctgcacaaaacgttcct
gagcgtgttaagcattatgaggttacatttgtgaatatggttcttcctaatactgagctt
atcactaaattgtcacataccggtatgattaatggacgtaagattatcaaggttgaagtc
ctcaaccaagaaacttcagaacctgttcttgtaggtactgctgaagtcgagcaacctgtt
tctgcatatgttttcaccggtcagggttctcaagaacagggtatgggtatggatctatat
gcttcaagtcccgtagctcgtaagatttgggacagtgccgacaagcacttcttaacgaac
tatggattctccattattgacattgtcaaacataatccccatagcatcaccattcacttt
ggtggttctaagggtaaaaagattcgtgataactatatggctatggcatacgaaaagctc
atggaagacggaactagcaaagttgtcccagtatttgaaaccattactaaggactctacc
tcgtttagtttcactcatccttccggcttattgtcagctactcaatttactcaacctgca
ctgacattgatggagaagtcggcatttgaagacatgcgttctaaaggtttagttcaaaac
gactgtgcctttgctggtcattctttgggtgaatattctgctttgtccgctatgggtgat
gttttgtctattgaggcattggtagacttagtatttttgcgtggcttaactatgcaaaac
gctgttcatcgtgatgaattgggacgttctgattatggtatggttgcagcaaacccttca
cgagtgtcagcttccttcaccgatgctgctttgcgttttatcgttgaccatattggccaa
cagaccaacttgttgcttgagattgtcaactataacgttgagaatcaacaatacgttgtt
agtggtaacttgttgagtttgtccactttaggtcatgtacttaactttttgaaggtccaa
aagatcgattttgaaaaacttaaggaaactttgactattgaacaattgaaagaacaactc
accgatatcgttgaagcatgtcatgctaagactttggagcaacaaaagaagactggccgc
attgagctggaacgtggatatgccacaattcccctcaaaattgatgtccccttccactcc
tcattcttgcgtggaggtgtaaggatgttcagagagtatttggtgaagaagatcttccct
caccaaattaacgttgccaagcttcgcggcaaatatattcctaacttgactgccaagcct
tttgagattagcaaagagtatttccagaatgtatatgatctaactggttcccaacgaatt
aaaaagattttgcaaaactgggatgaatatgagtcatcctag

DBGET integrated database retrieval system