KEGG   Schizosaccharomyces pombe (fission yeast): SPAC959.05cHelp
Entry
SPAC959.05c       CDS       T00076                                 

Definition
(RefSeq) putative protein disulfide isomerase
  KO
K13996  protein disulfide-isomerase [EC:5.3.4.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SPAC959.05c
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:spo03110]
    SPAC959.05c
Enzymes [BR:spo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SPAC959.05c
Chaperones and folding catalysts [BR:spo03110]
 Protein folding catalysts
  Protein disulfide isomerase
   SPAC959.05c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6
Motif
Other DBs
NCBI-GeneID: 2543474
NCBI-ProteinID: NP_594172
PomBase: SPAC959.05c
UniProt: Q9P4X1
Position
I:complement(join(3395685..3397327,3397383..3397638))
Genome map
AA seq 632 aa AA seqDB search
MKLFLYHFTFIVYYFIISFSYAFSIKQEIIVSSHNASSILNTTAFWFVEFTESKYDKEEF
SVIWNEVSMEFPDIRRAKVFCDLDLEFCAQQEIYDHPKVVVLKNGMWMRHVLEKNQITTK
SARQFVKSHLGNCDLEQAENETDCFSDDGEYNSDSSSTDPAFELKEDQSWKHSSILRPLE
TLNFKRFLFGNEIMSKTRAFVMFVSLKHCEDCFHWEAVWSSITRNTDERLKMAQVNCDEE
KEMCNHFHIKKFPTFRVFQGFDSIQYNGPLKYQQLLSYSNQVASYQAIKIEEGDIESIEN
SHPVFFLVLYDFATTSEDFSIIERLKLQLAGVAPLYICNSKALANKYGAQSQPSIIAVRN
GMPIVYQAITPREFRDYKRITEWINIVSSPFITELTPTKCHSLLNRKLTVLTLLQPDSEQ
FFSSQEELLRLGKRWFRFQMQRQRNDIVWSRIKKYSAIAEAKKKGFARKVKRIKYSKISH
PTYTESVSFLWLDSSLWLDWIVENLDHTVYVDSITPPVFVIDHSKGVIYVSDRNGNSLTL
EEDSLFSTLRIILEHPNSSRLQKLRAPGLCPNGSPNYRNRYKLIVFNLLIALLILSILTI
ISASRLSRRRRQLLNKQPVFGFYHSLVIAKSD
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcttcctttatcatttcactttcatagtctactactttattattagttttagt
tacgctttttcaattaagcaggagattatcgttagttcgcacaatgcttcgtccatcttg
aatactactgcattttggtttgtagagttcactgaaagcaaatatgataaggaagagttt
tctgttatttggaatgaagtttcaatggagtttcctgacatacgccgtgcaaaggtgttt
tgtgatttagaccttgaattttgcgctcaacaggaaatatatgatcatccaaaggtagta
gttctaaaaaatggtatgtggatgcgacacgttcttgaaaaaaatcaaattacgacaaaa
tccgcgcgacaatttgtaaaaagccatttgggtaattgtgatttggagcaagctgaaaat
gaaacagattgtttcagtgacgatggtgagtataatagtgattccagtagcacagatcct
gcttttgaactgaaagaagaccaatcgtggaaacactcgagtattttgaggcctttggag
acattgaactttaaaaggtttctttttggaaatgaaattatgtctaaaactcgtgcattc
gttatgtttgtttcattgaagcactgtgaagattgctttcattgggaagctgtttggtca
agcattactcgtaataccgacgagcgattaaaaatggcgcaagttaattgcgacgaagaa
aaggagatgtgtaatcatttccatattaaaaagtttcctaccttcagggtgtttcagggg
ttcgattccatacaatataatggacctctcaagtatcaacagctgctatcctattcaaac
caagtggcaagttaccaagcaataaagatcgaagaaggggacattgaatcaatcgaaaac
tctcacccagttttctttctggtgctttacgattttgcaactacttcagaagatttcagt
atcattgaacgtctgaaattacagcttgctggtgttgctccattatacatttgtaattcg
aaggcgctcgcgaataaatatggggcacagtctcagcctagcattattgctgttcgcaat
ggaatgccaatagtttatcaggcaattacaccccgtgagtttcgagattataaacgaatt
actgagtggattaacatagtttcctccccttttattacagagctaaccccgacaaaatgc
cacagtctgctgaatcgaaagcttactgttttgaccttacttcagccagattctgaacag
tttttttcaagtcaagaagaattgttgcggcttggaaagagatggtttcgatttcaaatg
caacgacaaagaaatgatatagtttggagtagaattaagaaatatagtgcgatagctgaa
gctaaaaagaaagggttcgcgaggaaagtgaagcgaattaagtactcgaagatatcacat
cctacttatactgagtcagtttcatttttatggttagattcttctttatggttggattgg
attgtggaaaatttggaccatactgtttatgtagattctatcacaccaccagtgtttgtg
atagatcactcgaaaggcgtaatctatgtgagtgacagaaacggcaactcacttacgtta
gaagaagattctctattttccacattaaggattatattagagcaccctaactcatctcgt
cttcaaaaactgcgtgcaccgggcctatgtccaaacggtagccccaattacaggaataga
tacaaacttatagtttttaatttgctcattgctttactaatattgagcatcctgacaatt
atttcagctagcaggctttcccgtcggcgtcgacaactgctgaacaagcaaccagttttt
ggtttttatcattcgcttgtaattgccaaatcagactga

DBGET integrated database retrieval system