KEGG   Schizosaccharomyces pombe (fission yeast): SPAC977.05c
Entry
SPAC977.05c       CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Vel1p
Other DBs
NCBI-GeneID: 2543096
NCBI-ProteinID: NP_592777
PomBase: SPAC977.05c
UniProt: Q9P7U4
Position
I:complement(35768..36382)
AA seq 204 aa
MIFKNLISLFFIGLATAIRFNLTDLECSRLRGPHCGTYLLKVVGTNATYVGEKSFIGLDA
LTESKGEFFQRMLEQEPRLIPRLFTIAENDTANFTPLTFTTYLKTCNPQSIENAMIPFVN
TVTSEISFDAWAYTAQNSSRITGLSNQLMNSTLYNVQVATCTPGFSALLLDSPTINVFNN
EEGMPSWCQPIELIPVCPLDEGFN
NT seq 615 nt   +upstreamnt  +downstreamnt
atgattttcaaaaacttaatatctctctttttcattgggctcgctaccgccatacgcttc
aacctcactgatcttgagtgtagtagactacgcggtccgcattgtggtacgtatctactg
aaagtagtaggaacgaatgctacatacgttggtgaaaaatcatttataggtcttgatgct
ttgactgaaagtaaaggtgaattttttcagcgtatgttggaacaagaacctcgacttatt
ccacgtttgtttacgatagctgaaaacgacacggccaactttactcccttgacatttaca
acgtatttgaaaacatgcaatcctcaaagtattgaaaatgcaatgatcccttttgtgaat
actgttaccagtgaaatttcttttgatgcatgggcgtatacagcacaaaattcaagtcgg
ataacgggtcttagcaaccaactgatgaattctactctatataatgttcaagtagcaaca
tgtactcccggattctctgcgttattgttagatagtcctacaatcaatgtttttaataac
gaggaaggcatgccaagttggtgtcagcccattgaacttataccagtttgtcctttggat
gagggattcaactga

DBGET integrated database retrieval system