KEGG   Schizosaccharomyces pombe (fission yeast): SPAC977.09c
Entry
SPAC977.09c       CDS       T00076                                 

Name
(RefSeq) putative phospholipase
  KO
K13333  lysophospholipase [EC:3.1.1.5]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SPAC977.09c
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SPAC977.09c
SSDB
Motif
Pfam: PLA2_B IBR
Other DBs
NCBI-GeneID: 2541836
NCBI-ProteinID: NP_592781
PomBase: SPAC977.09c SPBC1348.10c
UniProt: P0CU02 P0CU03
Position
I:complement(join(46075..46143,46208..48160))
AA seq 673 aa
MYVNYIGLFAFVQISLTLAYPPGRVEISEIYDFEESSSYKGQDIDTSVLYTLSKRKPALV
KRSTDASYAPFNVTCSNDNLLRPASEGLNEGEQSYINKRISKVNSELRSFISKTGLNVDL
DKVVNSSDGPRLGIAFSGGGLRAMVNGGGAFNAFDSRFESDSPLSGLLQSAMYISGLSGG
SWLVGSVAINNFTNITYLRDNVWNLEHSVFAPHGDNVIENLNYYNDLRKEIDQKKHAGFD
CSLTDLWGRALSRKLVDAERGGPGITYSSMRNQSWFQNADYPYPIIVADSRLEEETAIPA
NTSIFEFTAYEFGTWDNGIKAFIPMEYVGTHLLDGVPPDKSCIHNYDNAGFVMGTSATLF
NSFLLDWNENVKKNDTYYDILHAILEDLSKHQDDIAPYPNPYQNYTTSNTSVVNAFEPYD
TIDLVDGGEDRENIPLWPLLHPQRFVDVVFAIDSTYNDPYGWPLGSSIVATYERVVTFNA
NKSVDVRGFPYIPDENTIISLGLNTRPTFFGCDGKNTTAGNHDVDNNTPPLLVYFPNYPW
TYYSNISTFTMSMDDKMANGILENAFMSTTQNNNESFAVCLACAIIQRSLERKKLSTPTQ
CSSCFQEYCWDGTLATSTASVYDPTVMSAATTSRAPSGTTSGTASSTTSSSVASATPTHK
HWWDSIFEAKENP
NT seq 2022 nt   +upstreamnt  +downstreamnt
atgtatgtcaactatattggactctttgctttcgttcaaatttcgttgacgttagcttat
cctcccggtcgtgtggagatttctgaaatatatgattttgaagaatctagttcgtataaa
ggacaagatattgatacatccgtactttacactttgtctaaaaggaaacctgcgctcgta
aaacgaagtaccgacgcttcgtatgcccctttcaatgtgacctgttcaaacgacaatctg
ttgaggccggcttctgaaggtttaaatgagggcgaacagagctatatcaacaaacgtatt
tctaaggttaacagtgaactccgatcatttatttctaagacaggtttgaatgttgacttg
gataaggtggttaacagctcggatggtccacgtttaggaattgcattctcaggtggtggg
ttacgggcgatggttaatggaggtggtgcattcaatgcttttgactcaagattcgagagt
gactctccactttctggtctgctgcaatccgcgatgtatatcagcggtctttctggtggt
tcatggcttgttggatcagtggctattaataattttacgaatataacatacttacgtgat
aatgtctggaatttggaacatagcgtttttgctcctcatggggataatgtcattgaaaat
ttgaattattataatgacttgcgcaaagaaattgatcaaaagaaacatgcgggctttgac
tgttctttgacggatttatggggacgtgctttgtcccgtaaacttgttgatgctgaaagg
ggaggaccaggcattacatattccagtatgagaaatcaaagctggtttcaaaatgctgat
tatccttatcccatcatcgttgcggatagccgattagaagaagaaacggccatccctgcc
aataccagtatctttgagttcacggcgtatgaatttggtacatgggacaatggaattaaa
gcattcattccaatggaatatgtgggaactcacttgttggatggggttccacccgataag
tcttgcattcataactatgataatgcaggttttgttatgggcacttcagctactttattc
aactcttttcttcttgactggaatgaaaatgtcaaaaagaatgatacctattacgatatt
cttcatgcgattcttgaagatctttctaagcatcaagatgatattgctccttatcccaat
ccttaccaaaattatactacttccaatacctctgtagtgaatgcgttcgaaccgtatgat
actattgatctagttgatggtggtgaggatagggaaaacattcccctttggcctttgtta
cacccacaacgatttgtggacgttgtatttgcgattgattcgacttataatgatccttat
ggttggccccttggatcttccattgttgctacatatgagagagttgtaacctttaatgcg
aacaagagtgttgatgtgcgtggatttccatatattccggacgaaaacactattatctct
ttgggactaaacactcgtcctacgttttttggatgtgacggtaaaaatactacagcagga
aatcatgatgtagacaataataccccacctctccttgtatactttccaaattacccttgg
acttattattccaatatatcgacatttactatgagcatggacgacaagatggctaatgga
attcttgagaatgcatttatgtcgactacgcaaaacaataatgaatcttttgcagtttgc
ttagcatgcgctataattcaacgctctttggaacgcaagaaattgagtactcctacccag
tgctcttcttgtttccaagaatactgttgggacggaactcttgcaactagtacggcttct
gtatatgatcctaccgtaatgtctgctgcgacaacatctcgtgcaccgtcaggcacaacc
tcgggtacagcctctagtacaacatcttcatctgtagcatcagccactcccactcataaa
cattggtgggactcgattttcgaagcgaaagaaaatccgtaa

DBGET integrated database retrieval system