KEGG   Schizosaccharomyces pombe (fission yeast): SPAC977.11
Entry
SPAC977.11        CDS       T00076                                 

Definition
(RefSeq) CRCB domain protein
  KO
K06199  fluoride exporter
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPAC977.11
Transporters [BR:spo02000]
 Other transporters
  Pores ion channels [TC:1]
   SPAC977.11
SSDB
Motif
Pfam: CRCB
Other DBs
NCBI-GeneID: 2543234
NCBI-ProteinID: NP_592783
PomBase: SPAC977.11 SPBPB8B6.06c
UniProt: P0CU19 P0CU20
Position
I:55274..56209
AA seq 311 aa
MLLTQSYFCIMSMLGTLARLGLTALNTYPGAPFSGLLWVQFVGCVIMGFCQTESVFFPRP
KHNATFLLAITTGFCGSLTTFSSWMLQMFTGMANLDPFERRGRGYSFLSVVSDFMVTMCI
AMSSLIWGKQIGKTTGQWRIGKVAFAWPIPAHTHIVVRVLLLLLSICFFVGAAFYTAYTT
NVTHRGIGFSLIFSPFAALTRLYLARFLNSPQYFIPYGTLCANVFATLLLSIMYMIPQIT
HCTPVSRSVMYGIQNGFCAVLSTLSTFSNELHTMPIKRAYIYCIISVAISFSICVIVDGA
TAWGHGYTEKY
NT seq 936 nt   +upstreamnt  +downstreamnt
atgctattaacacagtcttacttttgtataatgtctatgttggggacgctagctcgtcta
ggacttactgcattaaacacatacccaggtgcaccgttttctggacttttatgggttcaa
tttgttggatgcgttattatgggattttgtcagacagagtctgttttctttcctcgaccc
aaacataatgctacttttttgctagccattactacaggtttttgtggatctcttacaacg
ttttcttcttggatgttgcaaatgtttacagggatggctaacttggatccatttgaacgt
aggggccgaggctattcatttttaagtgtggtttccgattttatggtaactatgtgcatt
gcgatgtccagcttaatatgggggaagcagattggaaaaacgacgggacagtggagaatt
ggcaaagttgcatttgcctggcctatcccggcgcacacgcatatcgtagtgcgggtatta
cttttgttactctcgatttgtttttttgttggtgcagcattttatacggcatatacaacc
aatgtgacacatcgtggcataggttttagtctaatattctctccttttgctgccttgaca
cgtttgtatcttgcgcgattccttaattcacctcaatattttattccctatggaactctt
tgtgccaatgtctttgctacacttttgctttctatcatgtacatgataccacaaatcaca
cactgcactcctgtgtctagaagtgtgatgtatggaatccaaaacggattttgtgctgta
ctctctaccctttcaacattctccaacgaactccacacaatgcctataaaacgagcatat
atttattgtataatttcagttgctatttccttttcaatatgtgtcattgtcgatggagct
actgcatggggtcatggttatactgaaaagtattag

DBGET integrated database retrieval system