KEGG   Schizosaccharomyces pombe (fission yeast): SPAC9E9.06cHelp
Entry
SPAC9E9.06c       CDS       T00076                                 

Definition
(RefSeq) threonine synthase (predicted)
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00260  Glycine, serine and threonine metabolism
spo00750  Vitamin B6 metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01230  Biosynthesis of amino acids
Module
spo_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPAC9E9.06c
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SPAC9E9.06c
Enzymes [BR:spo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SPAC9E9.06c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 2542653
NCBI-ProteinID: NP_594579
PomBase: SPAC9E9.06c
UniProt: Q42598
Position
I:complement(join(4445866..4447341,4447400..4447468))
Genome map
AA seq 514 aa AA seqDB search
MSSQVSYLSTRGGSSNFSFEEAVLKGLANDGGLFIPSEIPQLPSGWIEAWKDKSFPEIAF
EVMSLYIPRSEISADELKKLVDRSYSTFRHPETTPLKSLKNGLNVLELFHGPTFAFKDVA
LQFLGNLFEFFLTRKNGNKPEDERDHLTVVGATSGDTGSAAIYGLRGKKDVSVFILFPNG
RVSPIQEAQMTTVTDPNVHCITVNGVFDDCQDLVKQIFGDVEFNKKHHIGAVNSINWARI
LSQITYYLYSYLSVYKQGKADDVRFIVPTGNFGDILAGYYAKRMGLPTKQLVIATNENDI
LNRFFKTGRYEKADSTQVSPSGPISAKETYSPAMDILVSSNFERYLWYLALATEAPNHTP
AEASEILSRWMNEFKRDGTVTVRPEVLEAARRDFVSERVSNDETIDAIKKIYESDHYIID
PHTAVGVETGLRCLEKTKDQDITYICLSTAHPAKFDKAVNLALSSYSDYNFNTQVLPIEF
DGLLDEERTCIFSGKPNIDILKQIIEVTLSREKA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtctagccaagttagttatttatcgactcgtggtggatcttcaaatttttcttttgaa
gaggctgtgcttaagggtttggctaatgatggaggattgtttattccatcagaaatccct
cagctacctagcggatggattgaggcttggaaggacaaatccttccctgaaattgccttt
gaggtaatgtctttgtacattcctcgctctgaaatttcagctgatgaattgaaaaaattg
gttgatcgctcttactctaccttccgccacccagagactactcctctaaaatcattaaag
aacggtctcaatgtacttgagctcttccatggtcctacttttgcgttcaaagatgttgct
ttgcaatttcttggtaacctctttgaatttttccttactcgtaagaacggaaacaaacct
gaagacgaacgtgatcatctgaccgtggttggtgccactagtggtgacactggtagtgca
gctatctatggcttacgtggcaagaaggacgtttcagtttttatcttatttcccaatgga
cgtgtttcccctatccaagaagctcagatgactacagtcacagatcctaacgttcactgt
atcactgtgaacggcgtctttgacgattgtcaagatcttgttaaacaaatttttggcgat
gttgagtttaataagaagcatcatattggtgccgttaattctattaactgggctcgtatt
ctctctcaaattacctattacttatattcttatctttccgtttacaagcaaggaaaggct
gacgatgttcgtttcatcgttcccaccggtaattttggtgatattctcgctggttactac
gccaagcgtatgggcttacctactaaacaacttgttattgctactaacgagaatgatatt
ttgaatcgtttcttcaagactggtcgttatgaaaaagctgattctactcaagtttcgccc
agtggacctatttccgccaaagaaacttactctcctgcaatggacattttggtttcttct
aacttcgagcgttacttatggtatcttgcattagccactgaggctcctaatcatactcct
gctgaggcctcggaaattttgtctcgctggatgaatgaattcaaacgtgatggaacagtt
actgtccgtcccgaggttttggaagccgctagacgtgatttcgtgagtgaacgtgttagt
aatgatgaaaccattgatgctattaaaaaaatctatgaaagtgatcattatatcatcgac
ccacacactgctgttggcgtcgaaactggtcttcgttgcttagagaagactaaggaccag
gatattacctatatttgcctttccacagctcatcctgctaagtttgacaaagcagtaaac
cttgctctttcttcttatagtgattataactttaacacacaagtattaccgatagagttt
gatggcctcttggatgaggagcgcacctgcattttctcaggaaaacccaatattgacatt
cttaaacaaattattgaagttactctcagcagagagaaagcttag

DBGET integrated database retrieval system