KEGG   Schizosaccharomyces pombe (fission yeast): SPAC9E9.07c
Entry
SPAC9E9.07c       CDS       T00076                                 

Gene name
ypt2
Definition
(RefSeq) GTPase Ypt2
  KO
K07901  Ras-related protein Rab-8A
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:spo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    SPAC9E9.07c (ypt2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPAC9E9.07c (ypt2)
   03036 Chromosome and associated proteins [BR:spo03036]
    SPAC9E9.07c (ypt2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPAC9E9.07c (ypt2)
   04031 GTP-binding proteins [BR:spo04031]
    SPAC9E9.07c (ypt2)
Membrane trafficking [BR:spo04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    SPAC9E9.07c (ypt2)
 Autophagy
  Other autophagy associated proteins
    SPAC9E9.07c (ypt2)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    SPAC9E9.07c (ypt2)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SPAC9E9.07c (ypt2)
  Exosomal proteins of other body fluids (saliva and urine)
   SPAC9E9.07c (ypt2)
  Exosomal proteins of colorectal cancer cells
   SPAC9E9.07c (ypt2)
GTP-binding proteins [BR:spo04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    SPAC9E9.07c (ypt2)
Motif
Pfam: Ras Roc Arf RsgA_GTPase Gtr1_RagA MMR_HSR1 GTP_EFTU SRPRB AAA_29 AAA_16 MCM AAA_5
Other DBs
NCBI-GeneID: 2543280
NCBI-ProteinID: NP_594580
PomBase: SPAC9E9.07c
UniProt: P17609
Position
I:complement(4448915..4449517)
AA seq 200 aa
MSTKSYDYLIKLLLIGDSGVGKSCLLLRFSEDSFTPSFITTIGIDFKIRTIELDGKRIKL
QIWDTAGQERFRTITTAYYRGAMGILLLYDVTDKKSFDNVRTWFSNVEQHASENVYKILI
GNKCDCEDQRQVSFEQGQALADELGVKFLEASAKTNVNVDEAFFTLAREIKKQKIDAENE
FSNQANNVDLGNDRTVKRCC
NT seq 603 nt   +upstreamnt  +downstreamnt
atgtctacaaaatcctacgattatttaatcaaattacttctcataggagattcaggtgtg
ggaaaatcatgtcttcttctgagattttcggaagactcgtttaccccttcttttatcaca
acgattggaattgatttcaagattcgcacgattgaactagatggaaaacgtatcaaactc
caaatttgggacactgctggccaggaacgtttccgtaccattaccactgcttattatcgt
ggtgcaatgggtattttattgttatacgatgtaactgataaaaaatcatttgataacgtc
cgaacttggtttagtaacgttgaacaacatgctagtgaaaatgtttataaaatccttatt
ggaaataaatgtgattgtgaggatcagcgtcaggtctcctttgaacagggacaagcgtta
gccgatgagctgggcgttaaatttttagaagctagtgcgaagacgaacgtcaatgtagat
gaggcattttttacccttgcccgggaaataaaaaaacaaaagattgatgcagaaaacgaa
ttttccaaccaggcaaataacgttgacctcggaaacgatcgtacggtgaagaggtgttgt
tag

DBGET integrated database retrieval system