KEGG   Schizosaccharomyces pombe (fission yeast): SPACUNK12.02cHelp
Entry
SPACUNK12.02c     CDS       T00076                                 

Gene name
cmk1
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase Cmk1
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spo01001]
    SPACUNK12.02c (cmk1)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     SPACUNK12.02c (cmk1)
Protein kinases [BR:spo01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   SPACUNK12.02c (cmk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo APH YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 2542442
NCBI-ProteinID: NP_593464
PomBase: SPACUNK12.02c
UniProt: Q9P7I2
Position
I:complement(join(1737832..1738198,1738261..1738591,1738664..1738754,1738822..1738876,1738924..1739087))
Genome map
AA seq 335 aa AA seqDB search
MQQTYKPNTSALKDGAPKATVDQKQLLPCKYRVGRVLGGGTYATVREAVHIETNKMYAAK
IMNKKMMEKKQDFVKNEIAILKRVSYEHPNILHLVDFFETVNNLYLITELATGGELFDRI
CAKGSFYEADAAALMRTTTSAVKYLHDNGIVHRDLKPENLLYRSKDPNSDLLIADFGLSH
FYEDSQYYMLMTACGTPEYMAPEVFRRTGYGKPVDMWAIGVITYFLLSGYTPFARPSQVE
VIEAILANEYTFNDPCWSGISETAKDFIKKCLENDPSKRLTAADALKHPFLSEKRPATSN
LLPNVRENFNARKTFRTAYNAVRAFNTWKKLENKH
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaaacatacaaaccaaacacctcggccttgaaagacggtgctccaaaggctacg
gtggatcagaaacaactattaccttgcaaatatcgtgtcggtcgggttttgggaggcgga
acatatgcgacggttcgtgaagccgttcatatcgaaactaacaaaatgtatgcggctaag
attatgaataaaaagatgatggagaagaaacaagactttgtgaagaatgaaattgcaatt
ctaaaacgtgtttcttatgaacatcctaatatcttacacttggttgatttttttgaaact
gtgaataatctgtacttaatcactgaactggccaccggtggtgaactttttgatagaata
tgtgccaaaggttcattttatgaggccgatgctgctgctttaatgcgtactaccacatca
gcagttaagtacttgcatgacaatggaattgtacatcgagatttgaagccagaaaattta
ctttatcgctctaaagatccgaattcagatttgttaattgccgattttggattgtcccac
ttttatgaggattctcaatactatatgctcatgacggcatgtgggacaccagagtacatg
gcacccgaagtctttcgtcgaaccggatatggaaaacctgtagatatgtgggctattggc
gttataacttattttttactcagtggttatactccatttgctcgaccttctcaggttgaa
gttatagaagcaattttagctaacgagtacacttttaacgatccttgctggtctggcatt
tcagaaacggccaaggactttattaaaaaatgtttggaaaacgacccttcgaaacgttta
actgctgctgatgcgttgaagcaccccttcctgtctgaaaagcgtcccgcaacctccaat
ttgcttccaaacgtccgggaaaatttcaatgcaagaaaaacgttccgtactgcctataac
gctgtacgtgctttcaacacttggaaaaagcttgagaataagcattaa

DBGET integrated database retrieval system