KEGG   Schizosaccharomyces pombe (fission yeast): SPACUNK4.10Help
Entry
SPACUNK4.10       CDS       T00076                                 

Definition
(RefSeq) putative glyoxylate reductase
  KO
K00015  glyoxylate reductase [EC:1.1.1.26]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00630  Glyoxylate and dicarboxylate metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SPACUNK4.10
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.26  glyoxylate reductase
     SPACUNK4.10
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 AdoHcyase_NAD IlvN
Motif
Other DBs
NCBI-GeneID: 2542594
NCBI-ProteinID: NP_593968
PomBase: SPACUNK4.10
UniProt: O14075
Position
I:complement(join(2891216..2891258,2891310..2892175,2892432..2892527))
Genome map
AA seq 334 aa AA seqDB search
MTLSGKPAALLVGTLKHAHKEWEALGKYAELKTYSDGTREDFLAKCKTEFQNVKAICRTY
NSKFYMGIFDKEIIDNLPPSVKFICHLGAGYETVDVAACTARGIQVSHVPKAVDDATADV
GIFLMLGALRGFNQGIFELHKNNWNANCKPSHDPEGKTLGILGLGGIGKTMAKRARAFDM
KIVYHNRTPLPEEEAEGAEFVSFDDLLAKSDVLSLNLPLNAHTRHIIGKPEFQKMKRGIV
IVNTARGAVMDEAALVEALDEGIVYSAGLDVFEEEPKIHPGLLENEKVILLPHLGTNSLE
TQYKMECAVLMNVKNGIVNDSLPNLVPEQRGDIE
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgactcttagtggaaaacctgcagctttactcgttggcactttgaagcacgctcataag
gagtgggaagctcttggaaaatatgcagagttgaagacctacagcgatggcactcgcgaa
gacttcttggccaaatgcaaaaccgagtttcaaaatgtaaaggccatctgtcgtacttac
aactccaagttttacatgggcatttttgacaaggaaatcattgataatttgcccccatcc
gtcaagtttatctgccatttgggtgctggttatgaaactgttgatgtggctgcttgtacc
gctcgtggtattcaagtctcccacgttcccaaggctgtcgacgatgcaaccgccgacgtt
ggtatcttcttaatgttaggtgcccttcgtggatttaaccaaggtatctttgagttacac
aagaacaactggaatgcaaattgcaaaccctctcatgatcccgagggtaaaacgcttggt
attttgggtttgggcggtattggtaagaccatggccaagcgtgctcgcgcctttgacatg
aaaatcgtatatcacaatcgtactccccttcccgaggaagaagctgaaggtgccgagttt
gtctcatttgacgatcttttagccaagtcagatgtgctttccctcaatttgcccttgaat
gctcacacccggcatatcattggaaaaccagaatttcaaaagatgaagcgtggaattgtc
atcgtcaacactgcacgtggtgccgttatggatgaagctgctctcgtcgaagctctcgac
gaaggcatcgtttactctgccggtcttgacgtatttgaagaagagcccaaaattcatcct
ggtcttttggagaacgaaaaggtgattcttcttcctcatttaggtacaaacagtcttgag
acccaatacaaaatggaatgcgctgttctcatgaacgtcaaaaatggaattgtcaatgat
tcacttcccaatttggttcctgaacaacgtggtgatatagagtag

DBGET integrated database retrieval system