KEGG   Schizosaccharomyces pombe (fission yeast): SPACUNK4.14
Entry
SPACUNK4.14       CDS       T00076                                 

Gene name
mdb1
Definition
(RefSeq) BRCT domain protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: BRCT RTT107_BRCT_5 BRCT_2 BRCT_3
Other DBs
NCBI-GeneID: 2542517
NCBI-ProteinID: NP_593964
PomBase: SPACUNK4.14
UniProt: O14079
Structure
PDB: 
4S3H

Position
I:complement(join(2883184..2883489,2883542..2884783,2884840..2884932,2884987..2885220))
AA seq 624 aa
MEIQFGNQRCRMVNSGGFLATDGSHLKEMETDDVLVEFLNIEHQLFIRNIRAIVKIADTT
VLPSASDKKLLYYVFDETRVRINDTPVIFSKLEEDNANVNEGSKMGVMTVPNTPQKPNLQ
QQKFEAINANEDQIDYSSNLEQNYNSLIRQGSDQVIPLSRFASEKSALELEKELFSERIP
ESQSAAEPVLKVENSENDLDEKLVLDGQHVEGDHSSDTEEEVVSEDQKQLNKTDDESTFI
ESHQIYIQGETKSPSSVSQSLSGDPSLKPAEVFDRKQSAEINSPIEKDVNPQQNISDSSI
KNNSIHSDEVNPEVRPDLTPSNENEESKRSAPEIALKEKESTSQDESNREAEEAPISTNY
SFPSSSLEDQPDKNVQSSAVENKNKHTNLVTSSFNLTKPMKSFIRRNGLRVQESVTDETD
FVILGSPPLRRTHKFLLATSLGIPLVSSQYLTDCIKSGKVLDFRSYKYKDEEAEAKWGFR
LDDIHRRTCFNGKRLYITKAIRDSMVGDSIHGLYSILETSGAEIVGDIKRAQEKDTIILA
QPDNDQEGRNMSATGLNVYKIELVALSILRDRIDFDEFLIDYDADSPTKVIGKRNVSKAS
RTGQGRKRSSRSSWNKPSAKEQRT
NT seq 1875 nt   +upstreamnt  +downstreamnt
atggagatacagtttggaaatcagaggtgtaggatggtaaattctgggggttttctagct
actgatggttcccatctgaaggaaatggaaacagatgatgttcttgttgaattcttaaat
atagaacatcaactttttattcgaaatattcgagctatagttaaaatagccgatacaacg
gtgcttccatctgctagcgacaaaaagcttctttattatgtttttgacgaaacgagagta
agaatcaacgatactcctgtaattttttcaaaattagaggaggataatgcaaacgtgaat
gaaggatccaaaatgggagttatgactgtccctaataccccgcagaagccaaatttgcag
caacaaaaatttgaagcgatcaatgcgaatgaagatcaaattgattattcaagtaacttg
gaacaaaattacaattctttaattaggcaaggatctgaccaggtcattcccctttcgcga
ttcgcttcagaaaaaagtgctttagaattggaaaaggaactcttttctgagagaattcca
gaatcgcaatctgccgctgagcctgttcttaaagttgaaaactctgagaatgatttggac
gaaaaattggtattggacggtcaacatgtggaaggcgaccatagttctgacactgaagag
gaggttgtttctgaagatcaaaaacagttgaataagaccgacgatgagtcaacatttatt
gaatcacaccaaatttatatacaaggagaaacaaaatctccttcttctgtctcgcaatca
ttgagtggagacccatccttgaagccagcagaggtatttgatagaaagcaaagtgctgaa
ataaactcaccaattgagaaggatgtgaatccacagcaaaacatatcggacagctctata
aagaacaatagcattcacagtgatgaagtaaatccagaggttaggccagatttaaccccc
tccaacgaaaatgaagaaagtaaaagaagtgcgccggaaatcgctctcaaagagaaggaa
tccacatcccaggatgaaagtaacagagaagcagaagaggcaccaatttccactaattat
tctttcccctcatcatctttagaggatcaacctgacaagaatgtgcagtcctcggcagtt
gaaaataaaaacaagcacacaaatctggtaacgtcgagtttcaacctaactaaaccgatg
aaaagttttataaggagaaatggtctaagggtgcaagaaagtgtcacagacgaaaccgac
tttgtcatccttggttcacctccacttcggaggacacataagtttttactggcgacttct
ctaggtataccacttgtctcttctcaatacttgacagactgtataaaatcaggtaaagtt
ttagattttcgtagctacaaatataaagacgaggaagcagaagccaagtggggatttcgt
ttggacgatatccacagaagaacgtgtttcaatgggaaaagactatacattacaaaggca
attcgagattcgatggtaggggattctatacacggactttactcaattttggaaacatct
ggagctgagattgttggtgatattaaaagggctcaagagaaggacacaattatacttgct
caacctgacaacgatcaagaaggacggaatatgagtgctactggtttaaatgtgtacaag
attgaactagtagctttatccatcttgcgtgatcgaattgattttgatgaatttttgatt
gactatgatgctgacagtcccaccaaagtaattggaaaaagaaatgtctcaaaggcatcc
cgaaccgggcaaggaagaaaacgatcctctcgttcatcttggaacaaaccaagtgcaaag
gagcaaagaacataa

DBGET integrated database retrieval system