KEGG   Schizosaccharomyces pombe (fission yeast): SPAP8A3.04c
Entry
SPAP8A3.04c       CDS       T00076                                 

Gene name
hsp9
Definition
(RefSeq) heat shock protein Hsp9
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: HSP9_HSP12
Other DBs
NCBI-GeneID: 2542035
NCBI-ProteinID: NP_594943
PomBase: SPAP8A3.04c
UniProt: P50519
Position
I:complement(5320399..5320605)
AA seq 68 aa
MSDPARKSFTEQGKEKMTPDSSKSTLDKAKESITGAYDKVASAFTSDEDKSTSQEAHDKA
QRFVDDKL
NT seq 207 nt   +upstreamnt  +downstreamnt
atgtctgatcccgcaagaaagtcttttactgaacaaggcaaggagaaaatgactcctgac
tcctccaagtctaccctcgacaaggccaaggaatccattactggtgcctacgacaaggtc
gcctctgcttttacctctgacgaggacaagagcacctctcaagaggctcatgacaaggct
caacgctttgttgatgacaagttgtaa

DBGET integrated database retrieval system