KEGG   Schizosaccharomyces pombe (fission yeast): SPAPB17E12.07cHelp
Entry
SPAPB17E12.07c    CDS       T00076                                 

Gene name
sen2
Definition
(RefSeq) tRNA-splicing endonuclease subunit catalytic subunit Sen2 (predicted)
  KO
K15322  tRNA-splicing endonuclease subunit Sen2 [EC:4.6.1.16]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spo03016]
    SPAPB17E12.07c (sen2)
Enzymes [BR:spo01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.16  tRNA-intron lyase
     SPAPB17E12.07c (sen2)
Transfer RNA biogenesis [BR:spo03016]
 Eukaryotic Type
  tRNA spricing factors
   tRNA splicing endonucleases
    SPAPB17E12.07c (sen2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_int_endo tRNA_int_endo_N
Motif
Other DBs
NCBI-GeneID: 3361398
NCBI-ProteinID: NP_001018222
PomBase: SPAPB17E12.07c
UniProt: Q8TFH7
Position
I:complement(join(1277785..1278092,1278140..1278974))
Genome map
AA seq 380 aa AA seqDB search
MSKNHEVYKDALPISLAYPLPPIILTNPLTWIPYIYRYLFRKTPRQVQWQCQLHESDLSC
VVTDSEAIKKFWTSGFFGKGNLSRSEPTWHTRTKRSLGLLGFDEDLVAEEVTARRRFQRK
QFKAQRAYRENRARERQLLLENGKPIPASLEEDAELPEYLTKSLKDFSRVSENPYHITSV
PNVEHLQLTFPEAFFLASLGVLRINYENPNFELLPILKLFANIVANSVALTHDYSLQQSH
EDPIIEPDNKFLTELAAYFYFRQQGWVVKNGTKFSVDFLLYKKGPVFSHAEFAILLIPCV
GNKQKYNMQWHEVHCLNRVIAQVKKSLILCYVQCPSIEDFNKIWKNQASMNEWDWAESVL
RQYLIRCVTLRRWVPSRNRD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaaatcatgaagtttataaggatgcgctccctatttctttagcttatcctctt
cctcctattattcttactaatcctttaacctggataccatatatatatcggtacctattt
agaaagacacccaggcaagtacaatggcaatgtcagcttcatgaaagtgacctcagctgt
gttgtaacagatagtgaagctattaaaaaattttggacatcaggtttttttggaaaagga
aatttgtctcgtagcgagccaacttggcatacacgaactaagcgatcgctgggacttctt
ggatttgatgaagaccttgtagctgaggaagttaccgcgcgtaggagatttcagcgaaaa
caatttaaagcacaaagagcttatagggaaaatcgtgctcgtgagaggcaattactatta
gaaaatggcaagccgattccagcatctttagaagaagatgcagaacttcctgagtattta
acgaaatctcttaaagacttttcccgagtttccgaaaatccataccatattacttcagtg
cctaatgttgagcacctacagctaacatttccggaagccttttttttagcttctttggga
gtccttcgaatcaactacgaaaaccctaattttgaacttttacctattttaaagcttttt
gccaacatagttgctaattcagttgcccttactcatgattattctttacagcaaagccat
gaagaccctattattgagccggacaacaaatttttaactgaattggctgcttatttctac
tttcgtcagcaaggttgggttgtaaaaaacggaaccaaattttcggtggattttttattg
tacaaaaagggtccagttttcagccatgccgagtttgctattttgctaattccatgtgtt
ggaaacaaacaaaaatataacatgcaatggcatgaagttcattgtctaaatcgggtaatt
gcgcaagtgaaaaagagcctaatattatgctatgttcaatgtcctagcattgaagacttt
aataaaatatggaaaaatcaagcctcaatgaatgaatgggattgggcagagtctgtactt
cgacaatatttaattcgatgtgtaaccttaaggcgctgggttcctagcaggaatagagat
tag

DBGET integrated database retrieval system