KEGG   Schizosaccharomyces pombe (fission yeast): SPAPB1A10.02
Entry
SPAPB1A10.02      CDS       T00076                                 

Gene name
scm3
Definition
(RefSeq) CENP-A chaperone Scm3
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Scm3
Other DBs
NCBI-GeneID: 2543449
NCBI-ProteinID: NP_593516
PomBase: SPAPB1A10.02
UniProt: Q9HDY7
Position
I:1861934..1862944
AA seq 336 aa
MCNRQPKAVDLPPNYSCPHLLSFQSVEFNTNPTACDDVFCKRIESEKKYNDFLESLFKKY
GRDTSDIADEVDLATGEIIVNNGHLEALKTKDDIWDPTFNNLEISASNGYEKKLDSSIGN
PGEKAVSPVHIEDFQSPQIYKFKNLSLRDEMVSDCVFADEVPLASLFVENVCNETIPSQS
CVRLKINDKTRKVDASALEKKSCLLPNSSGTLTDQRGLDTIKHKSIEQNEILHVISDTLS
SPRRRNPLLSSPKTPLRRSFSKSKVRNSNSTKRRNFISLISMISPRPNLSTHHFNLGFQP
LSQQTSFSGSSTQNPHSSSTCKKAFCFQCISESKKC
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgtgcaatcgtcaaccgaaagccgttgacctgcctccaaactattcttgtccacatctg
ttgtcttttcagtctgtcgaatttaatactaatcctacggcttgtgatgatgtgttttgt
aaaagaattgagtccgaaaagaagtacaacgactttttggaatctcttttcaaaaaatat
ggacgcgacacttctgatatagctgatgaagtagatcttgcaactggtgaaattattgtt
aataatggacatctagaagctttaaaaacaaaagatgatatatgggatcctacatttaac
aaccttgaaatctcagcgtcaaatggatacgaaaaaaaattagactcaagcattggcaac
ccaggggaaaaagctgtttcaccagtccatatagaggattttcagtctccccagatctat
aaatttaaaaatctatcacttcgtgatgaaatggtgtcagattgtgtgtttgcagatgaa
gttcctttagcttcactttttgtggaaaatgtttgtaatgaaactataccctctcagtca
tgcgtgagactaaaaatcaatgataaaacaagaaaagttgatgcttcagctttggaaaaa
aaatcttgtctgttgccaaactcatcaggaacattaacagatcagcgtggtttggataca
atcaagcataaaagcatagaacaaaatgagattttgcacgtcatctctgatactttatct
tcaccgagaagaaggaaccctttattatcatctcctaaaactcctttacgtagatctttt
tctaagtcaaaagtccgaaactccaattctacaaaacgaagaaactttatttcattaatt
tcaatgatatcccctcgacctaatctttctacccatcattttaatcttggttttcaacct
ttaagtcaacaaacttcgttctcaggaagtagcactcagaaccctcattcttccagcact
tgtaaaaaagcattttgtttccaatgcatttctgagtcaaaaaaatgttga

DBGET integrated database retrieval system